Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.58
PubTator Score 6.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
psoriasis 6685 1.94059315931829E-90
non-small cell lung cancer 2798 3.53088802085643E-29
breast carcinoma 1614 9.80970600015824E-26
lung adenocarcinoma 2714 3.32483726828481E-17
lung carcinoma 2844 4.89084097210394E-12
ovarian cancer 8492 1.68368261504059E-9
colon cancer 1475 2.77518961008674E-9
posterior fossa group B ependymoma 1530 6.64374788987552E-8
ductal carcinoma in situ 1745 4.59460237493656E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 9.70254645506095E-5
adult high grade glioma 2148 1.07640054722621E-4
invasive ductal carcinoma 2950 2.03770598938192E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00126169206961774
Atopic dermatitis 944 0.00138957235027422
lung cancer 4473 0.00156063864105495
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00818663783295438
medulloblastoma, large-cell 6234 0.0143226684558414
non primary Sjogren syndrome sicca 840 0.0276712550713571
adrenocortical carcinoma 1427 0.0309560456670424
Disease Target Count Z-score Confidence
Tularemia 22 3.386 1.7

Expression

Synonym

Accession Q15124 B1AM46 B4DLQ6 Q5VYV3 Q8N527 Q9UDH4
Symbols PGMRP

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (1)

PMID Text
24963132 Aciculin interacts with filamin C and Xin and is essential for myofibril assembly.

AA Sequence

MEGSPIPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRY      1 - 70
FSRTAIEIVVQMAAANGIGRLIIGQNGILSTPAVSCIIRKIKAAGGIILTASHCPGGPGGEFGVKFNVAN     71 - 140
GGPAPDVVSDKIYQISKTIEEYAICPDLRIDLSRLGRQEFDLENKFKPFRVEIVDPVDIYLNLLRTIFDF    141 - 210
HAIKGLLTGPSQLKIRIDAMHGVMGPYVRKVLCDELGAPANSAINCVPLEDFGGQHPDPNLTYATTLLEA    211 - 280
MKGGEYGFGAAFDADGDRYMILGQNGFFVSPSDSLAIIAANLSCIPYFRQMGVRGFGRSMPTSMALDRVA    281 - 350
KSMKVPVYETPAGWRFFSNLMDSGRCNLCGEESFGTGSDHLREKDGLWAVLVWLSIIAARKQSVEEIVRD    351 - 420
HWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDSFEYVDPVDGTVT    421 - 490
KKQGLRIIFSDASRLIFRLSSSSGVRATLRLYAESYERDPSGHDQEPQAVLSPLIAIALKISQIHERTGR    491 - 560
RGPTVIT                                                                   561 - 567
//

Text Mined References (14)

PMID Year Title
24963132 2014 Aciculin interacts with filamin C and Xin and is essential for myofibril assembly, remodeling and maintenance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10867799 2000 Aciculin and its relation to dystrophin: immunocytochemical studies in human normal and Duchenne dystrophy quadriceps muscles.
9342213 1997 Characterisation of the promoter which regulates expression of a phosphoglucomutase-related protein, a component of the dystrophin/utrophin cytoskeleton predominantly expressed in smooth muscle.
8631316 1996 A novel dystrophin/utrophin-associated protein is an enzymatically inactive member of the phosphoglucomutase superfamily.
More...