Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.20
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.77534539063544E-11
ependymoma 2514 5.82284627878443E-8
atypical teratoid / rhabdoid tumor 4369 9.36813134292395E-8
non-small cell lung cancer 2798 1.10592562586784E-7
pediatric high grade glioma 2712 1.86186982209335E-4
glioblastoma 5572 3.3229192363328E-4
medulloblastoma, large-cell 6234 5.28524177389312E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00380035502002301
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00866740389401655
primary Sjogren syndrome 789 0.00911168974051915
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0123827263823949
group 4 medulloblastoma 1875 0.020409776146123
lung cancer 4473 0.030613922370456
Rheumatoid Arthritis 1171 0.0315278087948669
Disease Target Count Z-score Confidence
Cowpox 15 4.713 2.4
Dermatofibrosarcoma protuberans 16 3.653 1.8

Expression

Synonym

Accession Q15057 A8K2V4 Q8N5Z8 Q9UQR3
Symbols CENTB2
CNT-B2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (3)

PMID Text
25853217 ACAP2 is a functional homolog of C. elegans CNT-1 and its inactivation or downregulation in human cells may contribute to cancer development
18003747 ACAP2 has robust, constitutive Arf6 GAP activity in vivo, with little activity toward Arf1.
11050434 Centaurin beta2/KIAA0041, is a member of the centaurin family of ADP-ribosylation factor directed GTPase-activating proteins. Binding of phosphoinositides to a pleckstrin homology domain may regulate subcellular localisation and activity.

AA Sequence

MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQYS      1 - 70
SNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVK     71 - 140
NAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVLQSKRRSEILKSMLSFMYAHLAFFHQGYDLF    141 - 210
SELGPYMKDLGAQLDRLVVDAAKEKREMEQKHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNA    211 - 280
FKTWNRRWFSIQNNQLVYQKKFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQ    281 - 350
AWIKAVQTSIATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLA    351 - 420
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYEANVEKMGIKK    421 - 490
PQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVRS    491 - 560
NDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLDSKHLNPGLQLYRASYEKNLPKMAEALAHGA    561 - 630
DVNWANSEENKATPLIQAVLGGSLVTCEFLLQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQ    631 - 700
HATDEEGKDPLSIAVEAANADIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNR    701 - 770
FQQDSQKF                                                                  771 - 778
//

Text Mined References (22)

PMID Year Title
25853217 2015 Human ACAP2 is a homolog of C. elegans CNT-1 that promotes apoptosis in cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...