Property Summary

Ligand Count 1
NCBI Gene PubMed Count 34
PubMed Score 18.51
PubTator Score 22.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-04
Multiple myeloma 1332 1.8e-04
ovarian cancer 8520 7.8e-04
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 3.944 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.625 1.8e-04
ovarian cancer 1.600 7.8e-04
psoriasis 1.300 1.3e-04

Gene RIF (12)

AA Sequence

MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSV      1 - 70
RLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGS     71 - 140
SRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPR    141 - 210
LQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE                                    211 - 248
//

Text Mined References (46)

PMID Year Title