Property Summary

NCBI Gene PubMed Count 33
PubMed Score 17.81
PubTator Score 22.04

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.30410000197448E-4
Multiple myeloma 1328 1.83937725533559E-4
ovarian cancer 8492 7.76085306776545E-4
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 4.018 2.0


  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.625 0.000
psoriasis 1.300 0.000
ovarian cancer 1.600 0.001


Accession Q15056 A8K3R1 D3DXF6 D3DXF8 eIF-4H
Symbols WSCR1


  Ortholog (9)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
2012 confirmatory 2746 / 2655 / 285674 uHTS fluorescence polarization assay for the identification of translation initiation inhibitors (eIF4H)
2028 summary 0 / 0 / 0 Summary assay for the identification of translation initiation inhibitors (eIF4H)
435011 confirmatory 43 / 0 / 43 SAR analysis for the identification of translation initiation inhibitors (eIF4H)
449744 other 0 / 0 / 25 SAR analysis for the identification of translation initiation inhibitors (eIF4H) via a crosslinking assay

Gene RIF (11)

26498689 Results demonstrate that eukaryotic translation initiation factor 4H (eIF4H) plays a crucial role in translational control.
23776612 Eukaryotic Initiation Factor 4H Is under Transcriptional Control of p65/NF-kappaB.
21427765 Studies indicate that eIF4A (DDX2), together with its accessory proteins eIF4B and eIF4H, is thought to act as a helicase that unwinds secondary structures in the mRNA 5' UTR.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20473909 results suggest that eIF4H isoform 1 plays an important role in carcinogenesis through the activation of oncogenic signaling and could be a promising molecular target for cancer therapy
19847924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19369421 Data show that reduced levels of eIF4B, eIF4H, or polyA-binding protein, also trigger SG formation.
19203580 Study reports the topology of the eIF4A/4G/4H helicase complex, which is built from multiple experimentally observed domain-domain contacts.
18719248 The interaction of eIF4AI with two accessory factors, eIF4B and eIF4H, was studied.
18448541 eIF4H binding is required for herpes simplex virus virion host shutoff-induced degradation of many mRNAs, perhaps by targeting Vhs to mRNAs and to preferred sites within mRNAs.

AA Sequence

LQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE                                    211 - 248

Text Mined References (45)

PMID Year Title
26498689 2015 Key contribution of eIF4H-mediated translational control in tumor promotion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23776612 2013 Eukaryotic Initiation Factor 4H Is under Transcriptional Control of p65/NF-?B.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.