Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 3.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.100 0.005
psoriasis -1.500 0.000
osteosarcoma -1.587 0.018
glioblastoma 1.500 0.016
tuberculosis 1.100 0.000
non-small cell lung cancer -1.440 0.000
lung cancer -2.600 0.000
diabetes mellitus -2.300 0.011
adult high grade glioma 1.500 0.000
pilocytic astrocytoma 1.900 0.000
pancreatic carcinoma 1.100 0.005
ovarian cancer 1.400 0.000

Synonym

Accession Q15053 A8K9H6 Q2NKQ0
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
21956439 conclude that KIAA0040 might harbor a causal variant for AD and thus might directly contribute to risk for this disorder.
21703634 Several flanking SNPs of the top hits in the meta-analysis demonstrated borderline associations with alcohol dependence in the family sample for KIAA0040, NRD1 and THSD7B, respectively.

AA Sequence

MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKE      1 - 70
HLSIHLNMVPKCVHMHVTHTHTNSGSRYVGKYILLIKWSLAMYFVQGSTLSTVTKMSHGKALPDSDTYIQ     71 - 140
FPNQQGPHTPSIP                                                             141 - 153
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24829844 2013 Family-based association analysis of alcohol dependence implicates KIAA0040 on Chromosome 1q in multiplex alcohol dependence families.
21956439 2012 Genome-wide association study of alcohol dependence implicates KIAA0040 on chromosome 1q.
21703634 2011 A meta-analysis of two genome-wide association studies identifies 3 new loci for alcohol dependence.
18757439 2008 Tumor-associated galectin-3 modulates the function of tumor-reactive T cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...