Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 3.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 7.3e-03
Astrocytoma, Pilocytic 2.000 1.2e-06
diabetes mellitus -2.300 1.1e-02
glioblastoma 1.500 1.6e-02
hepatocellular carcinoma 1.100 5.9e-06
lung cancer -1.500 4.9e-03
non-small cell lung cancer -1.440 1.5e-18
osteosarcoma -1.587 1.8e-02
ovarian cancer 1.400 2.0e-08
pancreatic cancer 1.100 4.8e-03
pancreatic carcinoma 1.100 4.8e-03
psoriasis -1.500 1.4e-04
tuberculosis 1.100 4.5e-04

Gene RIF (2)

AA Sequence

MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKE      1 - 70
HLSIHLNMVPKCVHMHVTHTHTNSGSRYVGKYILLIKWSLAMYFVQGSTLSTVTKMSHGKALPDSDTYIQ     71 - 140
FPNQQGPHTPSIP                                                             141 - 153
//

Text Mined References (12)

PMID Year Title