Property Summary

NCBI Gene PubMed Count 24
PubMed Score 28.26
PubTator Score 14.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.100 2.5e-03
cystic fibrosis 1.441 1.5e-04
dermatomyositis 1.400 1.5e-04
Down syndrome 1.200 2.2e-03
glioblastoma 1.100 5.2e-03
intraductal papillary-mucinous adenoma (... 1.500 1.2e-04
intraductal papillary-mucinous carcinoma... 1.700 6.6e-04
intraductal papillary-mucinous neoplasm ... 1.700 1.3e-03
lung adenocarcinoma 1.086 1.7e-04
lung cancer -1.200 1.4e-04
medulloblastoma, large-cell -1.100 8.5e-04
Multiple myeloma 1.076 2.1e-02
osteosarcoma 2.544 4.2e-07
ovarian cancer -2.100 2.7e-08
pancreatic cancer -1.200 1.9e-02
pancreatic carcinoma -1.200 1.9e-02
psoriasis 1.400 9.7e-05
Rheumatoid arthritis -1.500 1.8e-02
spina bifida -1.188 4.7e-02

Gene RIF (5)

AA Sequence

MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASL      1 - 70
YLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLA     71 - 140
VMQGANVLVTQRKGNFFMGGSDGGYTIW                                              141 - 168
//

Text Mined References (26)

PMID Year Title