Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $6,420,870.5
PubMed Score 29.55
PubTator Score 14.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis -1.500 0.018
pancreatic cancer -1.200 0.019
Multiple myeloma 1.076 0.021
psoriasis 1.400 0.000
osteosarcoma 2.544 0.000
cystic fibrosis 1.441 0.000
astrocytoma 1.200 0.003
glioblastoma 1.100 0.005
medulloblastoma, large-cell -1.100 0.001
intraductal papillary-mucinous adenoma (... 1.500 0.000
intraductal papillary-mucinous carcinoma... 1.700 0.001
intraductal papillary-mucinous neoplasm ... 1.700 0.001
lung cancer -1.200 0.000
pancreatic carcinoma -1.200 0.019
lung adenocarcinoma 1.086 0.000
spina bifida -1.188 0.047
ovarian cancer -2.100 0.000
Down syndrome 1.200 0.002
dermatomyositis 1.400 0.000

Gene RIF (5)

PMID Text
22792345 methylation of DAZAP2 promoter was involved in downregulation of DAZAP2 in multiple myeloma cells.
22070932 In summary we established a new mechanism of IL17RB regulation-Smurf2 dependent degradation of its adaptor protein DAZAP2.
21274613 Lys residues might play important roles in regulating the intracellular dynamics of the PRTB protein.K153 in human PRTB is essential for its ubiquitin-dependent degradation
18854154 Knockdown of DAZ associated protein 2 (DAZAP2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17935665 DAZAP2 is downregulated in multiple myeloma samples and it may be a signal molecule in multiple myeloma cells. DAZAP2 is involved in the pathogenesis of MM

AA Sequence

MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASL      1 - 70
YLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLA     71 - 140
VMQGANVLVTQRKGNFFMGGSDGGYTIW                                              141 - 168
//

Text Mined References (25)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
22792345 2012 The effects of promoter methylation on downregulation of DAZAP2 in multiple myeloma cell lines.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
22070932 2012 Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21274613 2011 Evolutionary features and intracellular behavior of the PRTB protein.
19060904 2009 An empirical framework for binary interactome mapping.
17984221 2008 Proline-rich transcript in brain protein induces stress granule formation.
More...