Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.71
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 5.6e-06
medulloblastoma, large-cell 6241 1.2e-04
medulloblastoma 720 8.9e-04
Down syndrome 499 1.9e-03
dermatomyositis 966 4.3e-03
progressive supranuclear palsy 676 2.9e-02
lung cancer 4740 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.300 4.3e-03
Down syndrome 1.200 1.9e-03
lung cancer 1.100 4.0e-02
medulloblastoma -1.200 8.9e-04
medulloblastoma, large-cell -1.500 1.2e-04
ovarian cancer 2.800 5.6e-06
progressive supranuclear palsy -1.100 2.9e-02

Synonym

Accession Q15006 Q8WUE1
Symbols TTC35
KIAA0103

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDD      1 - 70
LALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEA     71 - 140
IRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLEL    141 - 210
SRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKY    211 - 280
SLKAVEDMLETLQITQS                                                         281 - 297
//

Text Mined References (19)

PMID Year Title