Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
R01 Count 1
Funding $810,022
PubMed Score 3.59
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma -1.200 0.001
medulloblastoma, large-cell -1.500 0.000
lung cancer 1.100 0.040
progressive supranuclear palsy -1.100 0.029
ovarian cancer 2.800 0.000
Down syndrome 1.200 0.002
dermatomyositis 1.300 0.004

Synonym

Accession Q15006 Q8WUE1
Symbols TTC35
KIAA0103

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDD      1 - 70
LALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEA     71 - 140
IRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLEL    141 - 210
SRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKY    211 - 280
SLKAVEDMLETLQITQS                                                         281 - 297
//

Text Mined References (19)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26190106 2015 A CRISPR-Based Screen Identifies Genes Essential for West-Nile-Virus-Induced Cell Death.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...