Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.50
PubTator Score 1.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
pediatric high grade glioma 1064 2.3e-06
glioblastoma 5792 7.5e-05

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma -1.100 7.5e-05
pediatric high grade glioma -1.100 2.3e-06

 GO Component (1)

Gene RIF (4)

AA Sequence

MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKCGYFFLDDTDPDSMKDFEIVDQPGLD      1 - 70
IFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANSNNMNKSESDQEDNDDIN     71 - 140
DNDWSYGSEKKAKKRKSDKNPNSPRRSKSLKHKNGELSNSDPFKYNNSTGISYETLGPEELRSLLTTQCG    141 - 210
VISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRLQWDGSSDL    211 - 280
SPSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTASGLGSNKKKKPKPPAPPTPSIYDDIN       281 - 347
//

Text Mined References (18)

PMID Year Title