Property Summary

NCBI Gene PubMed Count 21
Grant Count 14
R01 Count 5
Funding $1,323,047.17
PubMed Score 159.40
PubTator Score 14.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.200 0.001
posterior fossa group A ependymoma -2.700 0.000
oligodendroglioma -1.800 0.003
glioblastoma -2.800 0.001
medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -2.100 0.017
medulloblastoma, large-cell -2.700 0.014
primitive neuroectodermal tumor -2.500 0.012
adult high grade glioma -2.200 0.014
Pick disease -1.200 0.045
psoriasis 1.700 0.000

Gene RIF (11)

PMID Text
26448945 Thus, GPC6 and TMEM132D may serve as predictors of CD8+ T-lymphocyte infiltration and as favorable prognostic markers in early stage ovarian cancer with important consequences for diagnosis.
25974322 TMEM132D, COMT and GABRA6 gene polymorphisms may influence susceptibility to panic disorder(PD) and major depressive disorder(MDD)in Japanese adults; these variants may increase vulnerability to PD by modulating oligodendrocytes and GABA and dopaminergic functions in related brain regions, altering neuronal processing of anxiety-related emotionl signals
24495968 Enhanced amygdala gray matter volumes and anxiety-related (but not panic-specific) personality profiles are found in healthy normal carriers of the rs11060369 AA TMEM132D genotype.
22948381 TMEM132D was first identified as a possible candidate gene for panic disorder in a genome-wide association study conducted at the Max Planck Institute of Psychiatry in Munich.
22911938 data suggest that not only common but also putatively functional and/or rare variants within TMEM132D might contribute to the risk to develop anxiety disorders
21784300 We found no genome-wide statistically significant associations but identified several plausible candidate genes among findings at p < 5E-05: TMEM132D, LRRC7, SEMA3A, ALK, and STIP1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368705 TMEM132D may be an important new candidate gene for PD as well as more generally for anxiety-related behavior.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MCPSEMGTLWHHWSPVLISLAALFSKVTEGRGILESIQRFSLLPTYLPVTYHINNADVSFFLKEANQDIM      1 - 70
RNSSLQSRVESFLIYKSRRLPVLNASYGPFSIEQVVPQDLMLPSNPFGFTNKFSLNWKLKAHILRDKVYL     71 - 140
SRPKVQVLFHIMGRDWDDRSAGEKLPCLRVFAFRETREVRGSCRLQGDLGLCVAELELLSSWFSPPTVVA    141 - 210
GRRKSVDQPEGTPVELYYTVHPGGERGDCVREDARRSNGIRTGHSDIDESGPPLQRIGSIFLYQTHRKPS    211 - 280
LRELRLDNSVAIHYIPKTVRKGDVLTFPVSISRNSTEDRFTLRAKVKKGVNIIGVRASSPSIWDVKERTD    281 - 350
YTGKYAPAVIVCQKKAAGSENSADGASYEVMQIDVEVEEPGDLPATQLVTWQVEYPGEITSDLGVSKIYV    351 - 420
SPKDLIGVVPLAMEAEILNTAILTGKTVAVPVKVVSVEDDGTVTELLESVECRSSDEDVIKVSDRCDYVF    421 - 490
VNGKEMKGKVNVVVNFTYQHLSSPLEMTVWVPRLPLQIEVSDTELNQIKGWRVPIVSSRRPAGDSEEEED    491 - 560
DERRGRGCTLQYQHAMVRVLTQFVAEAAGPGGHLAHLLGSDWQVDITELINDFMQVEEPRIAKLQGGQIL    561 - 630
MGQELGMTTIQILSPLSDTILAEKTITVLDEKVTITDLGVQLVTGLSLSLQLSPGSNRAIFATAVAQELL    631 - 700
QRPKQEAAISCWVQFSDGSVTPLDIYDGKDFSLMATSLDEKVVSIHQDPKFKWPIIAAETEGQGTLVKVE    701 - 770
MVISESCQKSKRKSVLAVGTANIKVKFGQNDANPNTSDSRHTGAGVHMENNVSDRRPKKPSQEWGSQEGQ    771 - 840
YYGSSSMGLMEGRGTTTDRSILQKKKGQESLLDDNSHLQTIPSDLTSFPAQVDLPRSNGEMDGNDLMQAS    841 - 910
KGLSDLEIGMYALLGVFCLAILVFLINCVTFALKYRHKQVPFEEQEGMSHSHDWVGLSNRTELLENHINF    911 - 980
ASSQDEQITAIDRGMDFEESKYLLSTNSQKSINGQLFKPLGPIIIDGKDQKSEPPTSPTSKRKRVKFTTF    981 - 1050
TAVSSDDEYPTRNSIVMSSEDDIKWVCQDLDPGDCKELHNYMERLHENV                        1051 - 1099
//

Text Mined References (23)

PMID Year Title
26448945 2015 Overexpression of GPC6 and TMEM132D in Early Stage Ovarian Cancer Correlates with CD8+ T-Lymphocyte Infiltration and Increased Patient Survival.
25974322 2015 Association of TMEM132D, COMT, and GABRA6 genotypes with cingulate, frontal cortex and hippocampal emotional processing in panic and major depressive disorder.
25390645 2014 Genome-wide and gene-based association studies of anxiety disorders in European and African American samples.
24495968 2014 Higher anxiety and larger amygdala volumes in carriers of a TMEM132D risk variant for panic disorder.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22948381 2012 Replication and meta-analysis of TMEM132D gene variants in panic disorder.
22911938 2012 Rare variants in TMEM132D in a case-control sample for panic disorder.
More...