Property Summary

NCBI Gene PubMed Count 43
PubMed Score 52.22
PubTator Score 44.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.300 2.4e-07
astrocytic glioma -1.200 7.1e-03
atypical teratoid / rhabdoid tumor -3.500 7.0e-13
ependymoma -1.800 9.5e-04
glioblastoma -1.800 1.4e-05
group 3 medulloblastoma -1.800 2.9e-04
medulloblastoma, large-cell -3.600 2.3e-07
oligodendroglioma -1.200 2.6e-13
osteosarcoma -1.015 4.5e-02
primitive neuroectodermal tumor -2.300 5.5e-04
subependymal giant cell astrocytoma -3.660 5.0e-02

Protein-protein Interaction (7)

Gene RIF (21)

AA Sequence

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLN      1 - 70
RSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMN     71 - 140
ISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAA    141 - 210
PDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMST    211 - 280
LTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF         281 - 345
//

Text Mined References (45)

PMID Year Title