Property Summary

NCBI Gene PubMed Count 41
Grant Count 8
Funding $676,444.29
PubMed Score 49.59
PubTator Score 44.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.300 0.010
ependymoma -4.300 0.000
glioblastoma -4.400 0.000
oligodendroglioma -1.900 0.000
osteosarcoma -1.015 0.045
medulloblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -5.600 0.000
medulloblastoma, large-cell -5.400 0.000
primitive neuroectodermal tumor -2.400 0.034
pediatric high grade glioma -3.400 0.000
subependymal giant cell astrocytoma -3.660 0.050

Protein-protein Interaction (8)

Gene RIF (19)

PMID Text
27358143 OPCML plays an important role in gastric cancer, and may be a new prognostic indicator of gastric cancer.
25652468 the DNA methylation levels of OPCML and SFRP1 could be potential biomarkers for diagnosis of CCA with high specificity, sensitivity, and accuracy, in particular for biopsy specimens
24839818 Detection of OPCML hypermethylation in the serum is useful for diagnosis of ovarian carcinoma.
24616287 The generation and cardiac phenotype of single and double heterozygous gene-targeted OPCML and Neurotrimin knockout mice.
22585860 The OPCML tumor suppressor negatively regulates a specific spectrum of receptor tyrosine kinases in ovarian cancer cells by binding to their extracellular domain.
21833655 A strong association was found between an intronic SNP of the OPCML gene (rs1784519) and the risk of schizophrenia in the Thai population
21273058 opioid binding protein/cell adhesion molecule-like promoter methylation has a role in bladder carcinoma
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLN      1 - 70
RSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMN     71 - 140
ISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAA    141 - 210
PDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMST    211 - 280
LTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF         281 - 345
//

Publication (43)

PMID Year Title
27358143 Effect of OPCML gene on the biological behavior of gastric cancer cell line AGS.
26175934 2015 OPCML is frequently methylated in human colorectal cancer and its restored expression reverses EMT via downregulation of smad signaling.
25652468 2015 DNA methylation level of OPCML and SFRP1: a potential diagnostic biomarker of cholangiocarcinoma.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24839818 2014 Detection of circulating methylated opioid binding protein/cell adhesion molecule-like gene as a biomarker for ovarian carcinoma.
24616287 2014 Gene-targeted deletion of OPCML and Neurotrimin in mice does not yield congenital heart defects.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23942779 2013 A genome-wide association study of behavioral disinhibition.
More...