Property Summary

NCBI Gene PubMed Count 58
Grant Count 283
R01 Count 159
Funding $30,889,494.3
PubMed Score 840.74
PubTator Score 74.23

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14956 A4D155 Q6UVX1 Q8N1A1
Symbols NMB
HGFIN

Gene

Gene RIF (44)

PMID Text
26771826 Gpnmb Is a Potential Marker for the Visceral Pathology in Niemann-Pick Type C Disease
26636434 Osteoactivin in the extracellular matrix promotes oral squamous carcinoma cell adhesion and migration.
26581806 The GPNMB is a promising biomarker and therapeutic target for the development and progression of Nonalcoholic fatty liver disease in obesity.
26261527 GPNMB plays an important roles in regulating the expression of key pluripotency genes in dental pulp cells and modifying odontogenic differentiation.
26077887 GPNMB might be a surrogate marker for BC and may cross talk with the HER2 signal pathway.
25889792 The transcription factor MITF is a critical regulator of GPNMB expression in dendritic cells.
25772243 A positive correlation between GPNMB and NRP-1 levels in human breast tumors.
25658639 Data shows that the expression of Gpnmb and Spp1 is highly upregulated in glioma-associated microglia/macrophages highlighting the importance of macrophages and microglia as therapeutic targets in anti-tumor treatment regimens.
25594584 GPNMB mRNA in FLCN-related renal cell carcinomas was 23-fold more abundant than in sporadic tumors.
25426614 GPNMB/OA protein expression prevents cells from apoptosis-enhancing proliferation and represents a novel modulator of the invasion and metastasis in pancreatic cancer cells.
More...

AA Sequence

MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWK      1 - 70
NSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSE     71 - 140
DSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEV    141 - 210
TVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTIN    211 - 280
YKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNT    281 - 350
PGPAGDNPLELSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI    351 - 420
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTSTLISVPDRDP    421 - 490
ASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKD    491 - 560
PLLKNQEFKGVS                                                              561 - 572
//

Text Mined References (62)

PMID Year Title
26771826 2016 Gpnmb Is a Potential Marker for the Visceral Pathology in Niemann-Pick Type C Disease.
26636434 2016 Osteoactivin Promotes Migration of Oral Squamous Cell Carcinomas.
26581806 2015 Beneficial impact of Gpnmb and its significance as a biomarker in nonalcoholic steatohepatitis.
26261527 2015 Effects of GPNMB on proliferation and odontoblastic differentiation of human dental pulp cells.
26077887 2015 Clinical significance of glycoprotein nonmetastatic B and its association with HER2 in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889792 2015 The transcription factor MITF is a critical regulator of GPNMB expression in dendritic cells.
25772243 2015 GPNMB cooperates with neuropilin-1 to promote mammary tumor growth and engages integrin ?5?1 for efficient breast cancer metastasis.
25658639 2015 Glioma-associated microglia/macrophages display an expression profile different from M1 and M2 polarization and highly express Gpnmb and Spp1.
25594584 2015 Distinctive expression patterns of glycoprotein non-metastatic B and folliculin in renal tumors in patients with Birt-Hogg-Dubé syndrome.
More...