Property Summary

NCBI Gene PubMed Count 70
PubMed Score 130.81
PubTator Score 74.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (31)

Disease log2 FC p
acute quadriplegic myopathy 1.384 1.2e-04
adult high grade glioma 1.600 2.4e-02
Astrocytoma, Pilocytic 2.200 9.2e-04
atypical teratoid/rhabdoid tumor 1.800 1.7e-02
Becker muscular dystrophy 1.031 1.3e-02
Breast cancer 2.500 2.7e-02
cystic fibrosis 1.096 5.0e-04
diabetes mellitus -1.100 2.1e-02
Down syndrome 1.400 1.2e-02
Duchenne muscular dystrophy 1.809 9.9e-09
Endometriosis 1.044 2.5e-02
fibroadenoma -1.400 1.8e-02
gastric carcinoma 2.100 3.8e-02
glioblastoma 2.100 3.2e-04
head and neck cancer -1.500 2.2e-02
intraductal papillary-mucinous adenoma (... -4.300 1.2e-04
intraductal papillary-mucinous carcinoma... -3.600 1.3e-03
limb girdle muscular dystrophy 2A 1.459 3.4e-05
lung cancer -1.300 6.8e-04
lung carcinoma -4.200 4.6e-30
medulloblastoma, large-cell -1.200 4.4e-02
ovarian cancer -1.700 2.3e-03
pancreatic cancer 1.200 1.6e-02
pituitary cancer -3.100 1.1e-05
posterior fossa group A ependymoma 1.400 5.3e-04
primary pancreatic ductal adenocarcinoma 1.712 6.4e-04
primary Sjogren syndrome 1.300 2.6e-03
psoriasis -1.200 3.3e-06
subependymal giant cell astrocytoma 5.766 2.1e-03
tuberculosis -2.600 3.4e-06
ulcerative colitis 2.500 3.2e-05

Gene RIF (55)

AA Sequence

MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWK      1 - 70
NSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSE     71 - 140
DSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEV    141 - 210
TVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTIN    211 - 280
YKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNT    281 - 350
PGPAGDNPLELSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI    351 - 420
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTSTLISVPDRDP    421 - 490
ASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKD    491 - 560
PLLKNQEFKGVS                                                              561 - 572
//

Text Mined References (74)

PMID Year Title