Property Summary

NCBI Gene PubMed Count 145
PubMed Score 159.43
PubTator Score 29.12

Knowledge Summary

Patent

No data available

Gene RIF (128)

AA Sequence

MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPI      1 - 70
FHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERV     71 - 140
ILQCWSDIMFEHFFLHREWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPS    141 - 210
DPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF    211 - 280
PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKI    281 - 350
PFTILLFFLLHRWCSNKKKCCCNGPRACREQK                                          351 - 382
//

Text Mined References (148)

PMID Year Title