Property Summary

NCBI Gene PubMed Count 139
Grant Count 69
R01 Count 24
Funding $7,922,333.43
PubMed Score 143.91
PubTator Score 29.12

Knowledge Summary


No data available



Accession Q14943
Symbols KIR-G1


Gene RIF (125)

26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26109640 The data from this study contribute novel insight into how KIR3DS1-specific polymorphisms in the extracellular region impact KIR3DL1 surface expression, ligand binding, and inhibitory function.
25636577 genetic polymorphism is not related to acute myeloid leukemia in Chinese population
25491925 Moreover, the frequency of activating genotypes in the AS patient group was significantly higher than in the healthy control group (P < 0.05). KIR2DS1 and KIR3DS1
25253288 Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load.
25112829 Protective genotypes in HIV infection reflect superior function of KIR3DS1 over KIR3DL1-expressing CD8+ T cells.
24407110 KIR2DL3 and KIR3DS1 genes could be protector genes and immuno-genetic markers for Hepatits B in the Turkish population.
24059286 Different KIR3DS1, KIR3DL1 and HLA-Bw4 genotypes and levels of transcripts associate with HIV disease progression.
23789883 results suggest that the sole presence of KIR3DS1 could have a protective role in HIV-1 infection in highly exposed and persistently seronegative individuals
23613999 Results show that the KIR3DS1 genotype has a positive effect on HCV viral clearance during the first weeks of Peg-IFN/RBV treatment in HCV/HCV co-infected patients bearing genotype 1, and higher RVR and SVR rates.

AA Sequence

PFTILLFFLLHRWCSNKKNAAVMDQEPAGNRSEQRGF                                     351 - 387

Text Mined References (141)

PMID Year Title
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26109640 2015 KIR3DS1-Specific D0 Domain Polymorphisms Disrupt KIR3DL1 Surface Expression and HLA Binding.
25636577 2015 Comparison of the KIR3DS1/Bw4 distribution in Chinese healthy and acute myeloid leukemia individuals.
25491925 2015 Activating killer immunoglobulin-like receptors genes are associated with increased susceptibility to ankylosing spondylitis.
25253288 2014 Killer immunoglobulin-like receptor gene repertoire influences viral load of primary human cytomegalovirus infection in renal transplant patients.
25112829 2015 Protective genotypes in HIV infection reflect superior function of KIR3DS1+ over KIR3DL1+ CD8+ T cells.
24601832 2014 A novel full-length KIR3DS1*0130106 allele identified by sequencing.
24499056 2014 The KIR3DS1*0130105 allele identified using high-resolution sequence-based typing.
24407110 2014 Role of KIR genes and genotypes in susceptibility to or protection against hepatitis B virus infection in a Turkish cohort.
24405495 2014 Identification of the KIR3DL1*0050105 allele by sequence-based techniques.