Property Summary

NCBI Gene PubMed Count 26
Grant Count 5
R01 Count 5
Funding $1,485,000
PubMed Score 51.13
PubTator Score 31.15

Knowledge Summary

Patent (9,225)

Expression

Gene RIF (17)

PMID Text
26740212 Suppression of FXYD3 in MCF-7.
26410457 Study demonstrated that the expression of FXYD1, FXYD3 and FXYD5 is elevated in the lungs of Acute respiratory distress syndrome patients
22430872 All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis.
20805335 ExoS facilitates P. aeruginosa penetration through the intestinal epithelial barrier by binding to FXYD3 and thereby impairing the defense function of tight junctions against bacterial penetration.
20364041 Up-regulated expression of FXYD-3 protein may be involved in tumourgenesis and invasion of gastric adenocarcinoma.
20112499 Upregulation of FXYD3 is associated with glioma.
19955746 FXYD3 expression is related to several biological variables including ras, p53, legumain and PCNA, and may be involved in the development of the relatively early stages of colorectal cancers
19893046 inactivation of FXYD3 through a gene mutation or unknown mechanism could be one cause of the atypical shapes of cancer cells and play a potential role in the progression of lung cancer.
19571376 FXYD3a protein is highly expressed in breast cancers, and responsible for cancer cell proliferation.
19109419 FXYD3 silencing prevents proper regulation of Na,K-ATPase, which leads to perturbation of cellular Na+ and K+ homeostasis and changes in the expression of Na,K-ATPase isozymes, whose functional properties are incompatible with cell differentiation.
More...

AA Sequence

MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG      1 - 70
HHPGETPPLITPGSAQS                                                          71 - 87
//

Publication (27)

PMID Year Title
26740212 2016 Silencing overexpression of FXYD3 protein in breast cancer cells amplifies effects of doxorubicin and ?-radiation on Na(+)/K(+)-ATPase and cell survival.
26410457 2016 FXYD1 negatively regulates Na(+)/K(+)-ATPase activity in lung alveolar epithelial cells.
22430872 2012 Tissue-based proteomics reveals FXYD3, S100A11 and GSTM3 as novel markers for regional lymph node metastasis in colon cancer.
20805335 2010 Translocation of Pseudomonas aeruginosa from the intestinal tract is mediated by the binding of ExoS to an Na,K-ATPase regulator, FXYD3.
20364041 2010 Expression and significance of FXYD-3 protein in gastric adenocarcinoma.
20112499 2009 FXYD3 expression in gliomas and its clinicopathological significance.
19955746 2009 Expression of FXYD3 protein in relation to biological and clinicopathological variables in colorectal cancers.
19893046 2009 Down-regulation of FXYD3 expression in human lung cancers: its mechanism and potential role in carcinogenesis.
19571376 2009 FXYD3 protein involved in tumor cell proliferation is overproduced in human breast cancer tissues.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...