Property Summary

NCBI Gene PubMed Count 26
PubMed Score 58.44
PubTator Score 31.15

Knowledge Summary

Patent (9,225)

Expression

  Differential Expression (15)

Gene RIF (17)

AA Sequence

MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG      1 - 70
HHPGETPPLITPGSAQS                                                          71 - 87
//

Text Mined References (28)

PMID Year Title