Property Summary

NCBI Gene PubMed Count 74
Grant Count 58
R01 Count 46
Funding $4,353,510.43
PubMed Score 66.96
PubTator Score 71.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene

PDB

1KSQ  

Gene RIF (49)

PMID Text
25759826 role in olive-pollen sensitization
25605036 Dental pulp stem cells suppress the proliferation of lymphocytes via transforming growth factor-beta1
25529149 Combination of EGF with TGF-beta1, but not EGF or TGF-beta1 alone, caused assembly of cells to a new two-dimensional structure, being characterized by dense aggregates connected by branches of few cells.
25527259 The aim of this study is to evaluate whether specific inhibition of c-Abl by siRNA can influence the transforming growth factor-beta1 (TGF-beta1)-induced fibrotic responses.
25374198 This review concludes that TGF-beta1 29T/C polymorphism does not play a role in breast cancer susceptibility in overall or ethnicity-specific manner.
25369932 LTBP-1 an extracellular matrix protein and key regulator of TGF-beta bioavailability is a novel HtrA1 target.Attenuation of TGF-beta signaling caused by a lack of HtrA1-mediated LTBP-1 processing as mechanism underlying CARASIL pathogenesis.
25359706 Significantly higher frequency of TT genotype of transforming growth factor-Beta 1 in asthma patients was found compared to controls.
25190493 LTBP-1 showed both an accumulation and a striking co-localization with Notch3-ECD deposits suggesting specific recruitment into aggregates in brain in CADASIL.
24489852 The LTBP1 C-terminus adopts a flexible "knotted rope" structure, which may facilitate cell matrix interactions.
24164868 There is an increasing anti-cancer protection with increased numbers of alleles associated with higher levels of TGF-beta1 and IL-4.
More...

AA Sequence

MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNARYSRSSAAAG      1 - 70
APSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGGQLHPNPGGHPAAAPFTKQGRQVVR     71 - 140
SKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKAPGSQRCTKPSCVPPCQNGGMCLRPQLCVCK    141 - 210
PGTKGKACETIAAQDTSSPVFGGQSPGAASSWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVG    211 - 280
LPQQIHSQVTPLSSQSVVIHHGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNHTG    281 - 350
RIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQ    351 - 420
CPPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHP    421 - 490
PEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCF    491 - 560
QETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRVNNTFCQDINEC    561 - 630
QLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQ    631 - 700
LCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTH    701 - 770
PPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPV    771 - 840
VIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQ    841 - 910
RKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFR    911 - 980
CEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCAN    981 - 1050
GDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCED   1051 - 1120
IDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPD   1121 - 1190
GFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFC   1191 - 1260
DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSR   1261 - 1330
TSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEM   1331 - 1400
CPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDE   1401 - 1470
CQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPL   1471 - 1540
VGKQTTYTECCCLYGEAWGMQCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQ   1541 - 1610
DRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAK   1611 - 1680
CINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE                                1681 - 1721
//

Text Mined References (81)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25759826 2014 Polymorphisms of tumor necrosis factor-?, transforming growth factor-?, and interleukin-10 in asthma associated with olive pollen sensitization.
25605036 2015 Dental pulp stem cells suppress the proliferation of lymphocytes via transforming growth factor-?1.
25529149 2015 Cooperative effects of EGF, FGF, and TGF-?1 in prostate stromal cells are different from responses to single growth factors.
25527259 2015 Attenuation of fibrosis with selective inhibition of c-Abl by siRNA in systemic sclerosis dermal fibroblasts.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25374198 2014 No association of the TGF-?1 29T/C polymorphism with breast cancer risk in Caucasian and Asian populations: evidence from a meta-analysis involving 55,841 subjects.
25369932 2014 Cerebral small vessel disease-related protease HtrA1 processes latent TGF-? binding protein 1 and facilitates TGF-? signaling.
25359706 2015 Association of transforming growth factor-Beta 1 promoter variant -509 c/t with bronchial asthma in South Indian population.
25190493 2014 Sequestration of latent TGF-? binding protein 1 into CADASIL-related Notch3-ECD deposits.
More...