Property Summary

NCBI Gene PubMed Count 74
PubMed Score 66.96
PubTator Score 71.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.62081997514299E-11
ependymoma 2514 1.89875576041917E-11
malignant mesothelioma 3163 2.02578381478773E-8
pituitary cancer 1972 2.73054918860454E-7
Breast cancer 3099 1.89886807758597E-4
primary pancreatic ductal adenocarcinoma 1271 2.97241573640926E-4
pancreatic carcinoma 567 3.62062164500109E-4
pancreatic cancer 2300 5.19444591332022E-4
atypical teratoid/rhabdoid tumor 1095 0.00185531276980526
psoriasis 6685 0.00351750794577588
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00940129018178179
osteosarcoma 7933 0.0119823452538591
ovarian cancer 8492 0.0147061552834504
interstitial lung disease 292 0.0163548461880069
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0203669464710316
group 3 medulloblastoma 2254 0.0294166608507725
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
Idiopathic pulmonary fibrosis 21 3.242 1.6

Expression

  Differential Expression (16)

Gene

PDB

1KSQ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (49)

PMID Text
25759826 role in olive-pollen sensitization
25605036 Dental pulp stem cells suppress the proliferation of lymphocytes via transforming growth factor-beta1
25529149 Combination of EGF with TGF-beta1, but not EGF or TGF-beta1 alone, caused assembly of cells to a new two-dimensional structure, being characterized by dense aggregates connected by branches of few cells.
25527259 The aim of this study is to evaluate whether specific inhibition of c-Abl by siRNA can influence the transforming growth factor-beta1 (TGF-beta1)-induced fibrotic responses.
25374198 This review concludes that TGF-beta1 29T/C polymorphism does not play a role in breast cancer susceptibility in overall or ethnicity-specific manner.
25369932 LTBP-1 an extracellular matrix protein and key regulator of TGF-beta bioavailability is a novel HtrA1 target.Attenuation of TGF-beta signaling caused by a lack of HtrA1-mediated LTBP-1 processing as mechanism underlying CARASIL pathogenesis.
25359706 Significantly higher frequency of TT genotype of transforming growth factor-Beta 1 in asthma patients was found compared to controls.
25190493 LTBP-1 showed both an accumulation and a striking co-localization with Notch3-ECD deposits suggesting specific recruitment into aggregates in brain in CADASIL.
24489852 The LTBP1 C-terminus adopts a flexible "knotted rope" structure, which may facilitate cell matrix interactions.
24164868 There is an increasing anti-cancer protection with increased numbers of alleles associated with higher levels of TGF-beta1 and IL-4.
More...

AA Sequence

MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNARYSRSSAAAG      1 - 70
APSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGGQLHPNPGGHPAAAPFTKQGRQVVR     71 - 140
SKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKAPGSQRCTKPSCVPPCQNGGMCLRPQLCVCK    141 - 210
PGTKGKACETIAAQDTSSPVFGGQSPGAASSWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVG    211 - 280
LPQQIHSQVTPLSSQSVVIHHGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNHTG    281 - 350
RIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQ    351 - 420
CPPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHP    421 - 490
PEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCF    491 - 560
QETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRVNNTFCQDINEC    561 - 630
QLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQ    631 - 700
LCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTH    701 - 770
PPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPV    771 - 840
VIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQ    841 - 910
RKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFR    911 - 980
CEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCAN    981 - 1050
GDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCED   1051 - 1120
IDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPD   1121 - 1190
GFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFC   1191 - 1260
DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSR   1261 - 1330
TSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEM   1331 - 1400
CPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDE   1401 - 1470
CQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPL   1471 - 1540
VGKQTTYTECCCLYGEAWGMQCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQ   1541 - 1610
DRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAK   1611 - 1680
CINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE                                1681 - 1721
//

Text Mined References (81)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25759826 2014 Polymorphisms of tumor necrosis factor-?, transforming growth factor-?, and interleukin-10 in asthma associated with olive pollen sensitization.
25605036 2015 Dental pulp stem cells suppress the proliferation of lymphocytes via transforming growth factor-?1.
25529149 2015 Cooperative effects of EGF, FGF, and TGF-?1 in prostate stromal cells are different from responses to single growth factors.
25527259 2015 Attenuation of fibrosis with selective inhibition of c-Abl by siRNA in systemic sclerosis dermal fibroblasts.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25374198 2014 No association of the TGF-?1 29T/C polymorphism with breast cancer risk in Caucasian and Asian populations: evidence from a meta-analysis involving 55,841 subjects.
25369932 2014 Cerebral small vessel disease-related protease HtrA1 processes latent TGF-? binding protein 1 and facilitates TGF-? signaling.
25359706 2015 Association of transforming growth factor-Beta 1 promoter variant -509 c/t with bronchial asthma in South Indian population.
25190493 2014 Sequestration of latent TGF-? binding protein 1 into CADASIL-related Notch3-ECD deposits.
More...