Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.48
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRDSGGYYHPARL      1 - 70
GAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVADGGLQADPGEGEQQCGEASSP     71 - 140
EQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDLHAFAGSAAWDDSARAAGGQGLHVTAL        141 - 206
//

Text Mined References (17)

PMID Year Title