Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $24,901.6
PubMed Score 12.55
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20019842 Data show that the minor allele of rs869736 in the PTPRCAP promoter is associated with increased susceptibility to diffuse-type gastric cancer by increasing PTPRCAP expression.
20019842 Observational study of gene-disease association. (HuGE Navigator)
15372250 We analysed the C77G polymorphism in multiple sclerosis (MS) patients from the genetically homogeneous population of Sardinia. CD45 did not contribute to development of the disease in Sardinian MS.

AA Sequence

MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRDSGGYYHPARL      1 - 70
GAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVADGGLQADPGEGEQQCGEASSP     71 - 140
EQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDLHAFAGSAAWDDSARAAGGQGLHVTAL        141 - 206
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20019842 2009 A regulatory polymorphism at position -309 in PTPRCAP is associated with susceptibility to diffuse-type gastric cancer and gene expression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372250 2004 PTPRC (CD45) C77G mutation does not contribute to multiple sclerosis susceptibility in Sardinian patients.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12595907 2003 77 C/G mutation in the tyrosine phosphatase CD45 gene and autoimmune hepatitis: evidence for a genetic link.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11390434 2001 The transmembrane adaptor protein TRIM regulates T cell receptor (TCR) expression and TCR-mediated signaling via an association with the TCR zeta chain.
More...