Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4250.65
PubTator Score 1924.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIq 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Specific developmental disorder 9 0.0 1.1
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 0.0 4.0
Disease Target Count
COG2-CDG 1

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.100 6.8e-07
intraductal papillary-mucinous adenoma (... 1.200 3.9e-03
intraductal papillary-mucinous carcinoma... 2.100 2.3e-04
lung cancer 1.900 1.8e-02
osteosarcoma -2.155 1.5e-07
ovarian cancer -1.600 1.6e-10

Gene RIF (6)

AA Sequence

MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYAD      1 - 70
FVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSV     71 - 140
EKIEKILNSQSSKETSALEASSPLLTGQILERIATEFNQLQFHAVQSKGMPLLDKVRPRIAGITAMLQQS    141 - 210
LEGLLLEGLQTSDVDIIRHCLRTYATIDKTRDAEALVGQVLVKPYIDEVIIEQFVESHPNGLQVMYNKLL    211 - 280
EFVPHHCRLLREVTGGAISSEKGNTVPGYDFLVNSVWPQIVQGLEEKLPSLFNPGNPDAFHEKYTISMDF    281 - 350
VRRLERQCGSQASVKRLRAHPAYHSFNKKWNLPVYFQIRFREIAGSLEAALTDVLEDAPAESPYCLLASH    351 - 420
RTWSSLRRCWSDEMFLPLLVHRLWRLTLQILARYSVFVNELSLRPISNESPKEIKKPLVTGSKEPSITQG    421 - 490
NTEDQGSGPSETKPVVSISRTQLVYVVADLDKLQEQLPELLEIIKPKLEMIGFKNFSSISAALEDSQSSF    491 - 560
SACVPSLSSKIIQDLSDSCFGFLKSALEVPRLYRRTNKEVPTTASSYVDSALKPLFQLQSGHKDKLKQAI    561 - 630
IQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVE    631 - 700
YLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP                                    701 - 738
//

Text Mined References (16)

PMID Year Title