Property Summary

NCBI Gene PubMed Count 14
Grant Count 313
R01 Count 169
Funding $138,282,120.6
PubMed Score 3948.90
PubTator Score 1924.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.155 0.000
intraductal papillary-mucinous adenoma (... 2.300 0.000
intraductal papillary-mucinous carcinoma... 2.100 0.000
lung cancer 1.900 0.018
Breast cancer 1.100 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q14746 Q86U99 COG complex subunit 2
Symbols LDLC

Gene

Gene RIF (6)

PMID Text
24784932 Our data strongly suggest that these compound heterozygous mutations in COG2 are causative of CDG.
19105203 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of component of oligomeric golgi complex 2 (COG2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17975119 Observational study of gene-disease association. (HuGE Navigator)
17274799 The interaction between p115 and Cog2 was found to be essential for Golgi ribbon reformation after the disruption of the ribbon by p115 KD or brefeldin A treatment and recovery by re-expression of p115 or drug wash out, respectively.

AA Sequence

MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYAD      1 - 70
FVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSV     71 - 140
EKIEKILNSQSSKETSALEASSPLLTGQILERIATEFNQLQFHAVQSKGMPLLDKVRPRIAGITAMLQQS    141 - 210
LEGLLLEGLQTSDVDIIRHCLRTYATIDKTRDAEALVGQVLVKPYIDEVIIEQFVESHPNGLQVMYNKLL    211 - 280
EFVPHHCRLLREVTGGAISSEKGNTVPGYDFLVNSVWPQIVQGLEEKLPSLFNPGNPDAFHEKYTISMDF    281 - 350
VRRLERQCGSQASVKRLRAHPAYHSFNKKWNLPVYFQIRFREIAGSLEAALTDVLEDAPAESPYCLLASH    351 - 420
RTWSSLRRCWSDEMFLPLLVHRLWRLTLQILARYSVFVNELSLRPISNESPKEIKKPLVTGSKEPSITQG    421 - 490
NTEDQGSGPSETKPVVSISRTQLVYVVADLDKLQEQLPELLEIIKPKLEMIGFKNFSSISAALEDSQSSF    491 - 560
SACVPSLSSKIIQDLSDSCFGFLKSALEVPRLYRRTNKEVPTTASSYVDSALKPLFQLQSGHKDKLKQAI    561 - 630
IQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVE    631 - 700
YLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP                                    701 - 738
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24784932 2015 Mutations in COG2 encoding a subunit of the conserved oligomeric golgi complex cause a congenital disorder of glycosylation.
21269460 2011 Initial characterization of the human central proteome.
19105203 2009 An association analysis of Alzheimer disease candidate genes detects an ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17274799 2007 The interaction of two tethering factors, p115 and COG complex, is required for Golgi integrity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16406524 2006 Retrograde transport on the COG railway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...