Property Summary

NCBI Gene PubMed Count 5
Grant Count 6
Funding $1,261,978
PubMed Score 135.26
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.400 0.000
pancreatic ductal adenocarcinoma liver m... 1.763 0.005

Gene RIF (2)

PMID Text
18638446 TETRAN is a novel human organic anion transporter, and that it serves as a transporter for some NSAIDs and various other organic anions at the final excretion step.
17362938 A BLAST search identified the possible human orthologue of Tpo1p, tetracycline transporter-like protein (TETRAN), whose overexpression in cultured human cells caused resistance to some NSAIDs, suggesting that TETRAN is an efflux pump for some NSAIDs.

AA Sequence

MGWGGGGGCTPRPPIHQQPPERRVVTVVFLGLLLDLLAFTLLLPLLPGLLESHGRAHDPLYGSWQGGVDW      1 - 70
FATAIGMPVEKRYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATSRSF     71 - 140
AAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLF    141 - 210
AASDLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYF    211 - 280
LYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAF    281 - 350
LLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVAGYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYW    351 - 420
LAGAQACFTTWSGLFLLPFFLLQKLSYPAQTLKAE                                       421 - 455
//

Text Mined References (8)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
18638446 2008 Expression and function of TETRAN, a new type of membrane transporter.
17362938 2007 Identification of the TPO1 gene in yeast, and its human orthologue TETRAN, which cause resistance to NSAIDs.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8353488 1993 A gene from chromosome 4p16.3 with similarity to a superfamily of transporter proteins.