Property Summary

NCBI Gene PubMed Count 5
PubMed Score 146.28
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.763 4.6e-03
psoriasis 1.400 8.8e-05

Synonym

Accession Q14728 Q07706
Symbols TETRAN
TETTRAN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MGWGGGGGCTPRPPIHQQPPERRVVTVVFLGLLLDLLAFTLLLPLLPGLLESHGRAHDPLYGSWQGGVDW      1 - 70
FATAIGMPVEKRYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATSRSF     71 - 140
AAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLF    141 - 210
AASDLLFIFCFLPETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYF    211 - 280
LYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAF    281 - 350
LLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVAGYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYW    351 - 420
LAGAQACFTTWSGLFLLPFFLLQKLSYPAQTLKAE                                       421 - 455
//

Text Mined References (8)

PMID Year Title