Property Summary

NCBI Gene PubMed Count 42
Grant Count 921
R01 Count 514
Funding $138,014,180.35
PubMed Score 36.08
PubTator Score 124.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.002
osteosarcoma 2.155 0.000
group 4 medulloblastoma 1.400 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q14703 A8K6V8 Q24JQ2 Q9UF67
Symbols S1P
PCSK8
SKI-1

Gene

PANTHER Protein Class (3)

Gene RIF (18)

PMID Text
26645686 primordial SKI-1/S1P likely contained a simpler prodomain consisting of the highly conserved AB fragment that represents an independent folding unit
26108224 S1P substrate-dependent regulatory mechanisms for lipid synthesis and biogenesis of lysosomes are different
25378398 Incompletely matured forms of SKI-1/S1P further process cellular and viral substrates in distinct subcellular compartments.
25000985 The interaction between S1P and C5a plays an important role in neutrophils for antineutrophil cytoplasmic antibody -mediated activation
23884247 We show that SKI-1 is constitutively expressed in human pigment cells with higher SKI activity in seven out of eight melanoma cell lines compared with normal melanocytes.
23536681 Y285 of SKI-1 is crucial for the efficient processing of envelope glycoproteins from Old World and clade C New World arenavirus.
23360427 Diabetic high-density lipoprotein carries higher levels of S1P compared with normal high-density lipoprotein.
21719679 study found that the N-acetylglucosamine-1-phosphotransferase alpha/beta-subunit precursor is cleaved by S1P that activates sterol regulatory element-binding proteins in response to cholesterol deprivation; S1P functions in the biogenesis of lysosomes
21568902 The role of MBTPS1 (SKI-1/S1P) peptides in cancer and approaches used to inhibit SKI-1/S1P were studied.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARN      1 - 70
SFISSALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAE     71 - 140
SDPTVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGA    141 - 210
NVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTN    211 - 280
NQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPA    281 - 350
DQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVV    351 - 420
AGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSPSYID    421 - 490
LTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQNGDNIEVAFSYSSVLWPWSG    491 - 560
YLAISISVTKKAASWEGIAQGHVMITVASPAETESKNGAEQTSTVKLPIKVKIIPTPPRSKRVLWDQYHN    561 - 630
LRYPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEE    631 - 700
EYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFS    701 - 770
DGLYEGEFTLANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGR    771 - 840
IVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSK    841 - 910
VLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGES    911 - 980
GAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTP    981 - 1050
SV                                                                       1051 - 1052
//

Text Mined References (45)

PMID Year Title
26645686 2016 Mechanism of Folding and Activation of Subtilisin Kexin Isozyme-1 (SKI-1)/Site-1 Protease (S1P).
26108224 2015 Site-1 protease-activated formation of lysosomal targeting motifs is independent of the lipogenic transcription control.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25378398 2014 Zymogen activation and subcellular activity of subtilisin kexin isozyme 1/site 1 protease.
25000985 2014 The interaction between C5a and sphingosine-1-phosphate in neutrophils for antineutrophil cytoplasmic antibody mediated activation.
23884247 2014 Inhibition of the prohormone convertase subtilisin-kexin isoenzyme-1 induces apoptosis in human melanoma cells.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23536681 2013 Differential recognition of Old World and New World arenavirus envelope glycoproteins by subtilisin kexin isozyme 1 (SKI-1)/site 1 protease (S1P).
23360427 2013 High-density lipoprotein of patients with type 2 diabetes mellitus upregulates cyclooxgenase-2 expression and prostacyclin I-2 release in endothelial cells: relationship with HDL-associated sphingosine-1-phosphate.
22934019 2012 The endoplasmic reticulum stress response in aging and age-related diseases.
More...