Property Summary

Ligand Count 17
NCBI Gene PubMed Count 43
PubMed Score 34.89
PubTator Score 124.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Liver carcinoma 240
Disease Target Count P-value
ovarian cancer 8520 1.3e-07
osteosarcoma 7950 7.9e-07
group 4 medulloblastoma 1855 2.2e-04
psoriasis 6694 2.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Lassa fever 9 3.277 1.6
Crimean-Congo hemorrhagic fever 9 3.079 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.100 2.2e-04
osteosarcoma 2.155 7.9e-07
ovarian cancer -1.600 1.3e-07
psoriasis 1.200 2.2e-03

Protein-protein Interaction (4)

Gene RIF (19)

AA Sequence

MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARN      1 - 70
SFISSALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAE     71 - 140
SDPTVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGA    141 - 210
NVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTN    211 - 280
NQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPA    281 - 350
DQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVV    351 - 420
AGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSPSYID    421 - 490
LTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQNGDNIEVAFSYSSVLWPWSG    491 - 560
YLAISISVTKKAASWEGIAQGHVMITVASPAETESKNGAEQTSTVKLPIKVKIIPTPPRSKRVLWDQYHN    561 - 630
LRYPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEE    631 - 700
EYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFS    701 - 770
DGLYEGEFTLANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGR    771 - 840
IVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSK    841 - 910
VLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGES    911 - 980
GAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTP    981 - 1050
SV                                                                       1051 - 1052
//

Text Mined References (46)

PMID Year Title