Property Summary

NCBI Gene PubMed Count 42
PubMed Score 36.08
PubTator Score 124.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 7.9478998926639E-7
ovarian cancer 8492 3.22400542958266E-5
group 4 medulloblastoma 1875 1.81358259486257E-4
psoriasis 6685 0.00217299069923345
Disease Target Count Z-score Confidence
Lassa fever 10 3.335 1.7
Crimean-Congo hemorrhagic fever 10 3.143 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.002
osteosarcoma 2.155 0.000
group 4 medulloblastoma 1.400 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q14703 A8K6V8 Q24JQ2 Q9UF67
Symbols S1P
PCSK8
SKI-1

Gene

PANTHER Protein Class (3)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (18)

PMID Text
26645686 primordial SKI-1/S1P likely contained a simpler prodomain consisting of the highly conserved AB fragment that represents an independent folding unit
26108224 S1P substrate-dependent regulatory mechanisms for lipid synthesis and biogenesis of lysosomes are different
25378398 Incompletely matured forms of SKI-1/S1P further process cellular and viral substrates in distinct subcellular compartments.
25000985 The interaction between S1P and C5a plays an important role in neutrophils for antineutrophil cytoplasmic antibody -mediated activation
23884247 We show that SKI-1 is constitutively expressed in human pigment cells with higher SKI activity in seven out of eight melanoma cell lines compared with normal melanocytes.
23536681 Y285 of SKI-1 is crucial for the efficient processing of envelope glycoproteins from Old World and clade C New World arenavirus.
23360427 Diabetic high-density lipoprotein carries higher levels of S1P compared with normal high-density lipoprotein.
21719679 study found that the N-acetylglucosamine-1-phosphotransferase alpha/beta-subunit precursor is cleaved by S1P that activates sterol regulatory element-binding proteins in response to cholesterol deprivation; S1P functions in the biogenesis of lysosomes
21568902 The role of MBTPS1 (SKI-1/S1P) peptides in cancer and approaches used to inhibit SKI-1/S1P were studied.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARN      1 - 70
SFISSALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAE     71 - 140
SDPTVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGA    141 - 210
NVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTN    211 - 280
NQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPA    281 - 350
DQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVV    351 - 420
AGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSPSYID    421 - 490
LTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQNGDNIEVAFSYSSVLWPWSG    491 - 560
YLAISISVTKKAASWEGIAQGHVMITVASPAETESKNGAEQTSTVKLPIKVKIIPTPPRSKRVLWDQYHN    561 - 630
LRYPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEE    631 - 700
EYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFS    701 - 770
DGLYEGEFTLANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGR    771 - 840
IVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSK    841 - 910
VLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGES    911 - 980
GAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTP    981 - 1050
SV                                                                       1051 - 1052
//

Text Mined References (45)

PMID Year Title
26645686 2016 Mechanism of Folding and Activation of Subtilisin Kexin Isozyme-1 (SKI-1)/Site-1 Protease (S1P).
26108224 2015 Site-1 protease-activated formation of lysosomal targeting motifs is independent of the lipogenic transcription control.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25378398 2014 Zymogen activation and subcellular activity of subtilisin kexin isozyme 1/site 1 protease.
25000985 2014 The interaction between C5a and sphingosine-1-phosphate in neutrophils for antineutrophil cytoplasmic antibody mediated activation.
23884247 2014 Inhibition of the prohormone convertase subtilisin-kexin isoenzyme-1 induces apoptosis in human melanoma cells.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23536681 2013 Differential recognition of Old World and New World arenavirus envelope glycoproteins by subtilisin kexin isozyme 1 (SKI-1)/site 1 protease (S1P).
23360427 2013 High-density lipoprotein of patients with type 2 diabetes mellitus upregulates cyclooxgenase-2 expression and prostacyclin I-2 release in endothelial cells: relationship with HDL-associated sphingosine-1-phosphate.
22934019 2012 The endoplasmic reticulum stress response in aging and age-related diseases.
More...