Property Summary

NCBI Gene PubMed Count 29
PubMed Score 10.34
PubTator Score 9.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.370 2.3e-06
astrocytoma 1.400 1.5e-03
colon cancer 1.200 3.0e-04
intraductal papillary-mucinous carcinoma... -1.100 1.4e-02
juvenile dermatomyositis 1.477 2.2e-11
lung cancer 1.100 2.7e-03
medulloblastoma, large-cell 1.100 9.3e-04
Multiple myeloma 1.055 5.8e-03
ovarian cancer -1.100 1.6e-03
tuberculosis and treatment for 6 months 1.200 5.3e-04

Gene RIF (13)

AA Sequence

MAPAMQPAEIQFAQRLASSEKGIRDRAVKKLRQYISVKTQRETGGFSQEELLKIWKGLFYCMWVQDEPLL      1 - 70
QEELANTIAQLVHAVNNSAAQHLFIQTFWQTMNREWKGIDRLRLDKYYMLIRLVLRQSFEVLKRNGWEES     71 - 140
RIKVFLDVLMKEVLCPESQSPNGVRFHFIDIYLDELSKVGGKELLADQNLKFIDPFCKIAAKTKDHTLVQ    141 - 210
TIARGVFEAIVDQSPFVPEETMEEQKTKVGDGDLSAEEIPENEVSLRRAVSKKKTALGKNHSRKDGLSDE    211 - 280
RGRDDCGTFEDTGPLLQFDYKAVADRLLEMTSRKNTPHFNRKRLSKLIKKFQDLSEGSSISQLSFAEDIS    281 - 350
ADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAA    351 - 420
PSLEQNRGREPEASGLKALKARVAEPGAEATSSTGEESGSEHPPAVPMHNKRKRPRKKSPRAHREMLESA    421 - 490
VLPPEDMSQSGPSGSHPQGPRGSPTGGAQLLKRKRKLGVVPVNGSGLSTPAWPPLQQEGPPTGPAEGANS    491 - 560
HTTLPQRRRLQKKKAGPGSLELCGLPSQKTASLKKRKKMRVMSNLVEHNGVLESEAGQPQALGSSGTCSS    561 - 630
LKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTD    631 - 700
KSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTTTPRRRPRAMDFF                701 - 758
//

Text Mined References (43)

PMID Year Title