Property Summary

NCBI Gene PubMed Count 41
PubMed Score 2148.71
PubTator Score 2562.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.948 0.000
pancreatic ductal adenocarcinoma liver m... -2.371 0.004

Synonym

Accession Q14624 B7Z545 E9PGN5 Q15135 Q9P190 Q9UQ54 ITI heavy chain H4
Symbols H4P
IHRP
GP120
PK120
ITIHL1
PK-120
ITI-HC4

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (16)

PMID Text
26408095 ITIH4 peptide isoform as a preterm birth biomarker and its associated SNP implications
26206863 confirmed the association of schizophrenia with ITIH3/4 in a Han Chinese population
25977605 Serum ITIH4 may be a PM10-specific biomarker in COPD and may be related to inflammation.
24884609 Isoform-specific ITIH4 glycosylation and utilization of O-glycosylation sites on ITIH4 differs between cell lines and serum.
24861553 Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations.
24836184 Worse survival among HCC patients with low ITIH4.
24461634 A novel association between suicide attempt and the ITIH3/4-region in a combined group of patients with bipolar disorder, schizophrenia and related psychosis spectrum disorders.
23436019 Expression of the 85 kDa ITIH4 was substantial in amyotrophic lateral sclerosis compared with controls or patients with muscular dystrophy, Alzheimer diseases, or Parkinson diseases
23417432 A truncated fragment of inter-alpha-trypsin inhibitor heavy chain 4 was the sole protein found to be significantly enhanced in the prostate cancer patients compared to the controls.
21331437 Findings suggest that ITI-H4 expression may be used as a biomarker, which could facilitate the development of novel diagnostic and therapeutic tools.
More...

AA Sequence

MKPPRPVRTCSKVLVLLSLLAIHQTTTAEKNGIDIYSLTVDSRVSSRFAHTVVTSRVVNRANTVQEATFQ      1 - 70
MELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKATGRNMEQFQVSVSVAPNAKI     71 - 140
TFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNKTK    141 - 210
AHIRFKPTLSQQQKSPEQQETVLDGNLIIRYDVDRAISGGSIQIENGYFVHYFAPEGLTTMPKNVVFVID    211 - 280
KSGSMSGRKIQQTREALIKILDDLSPRDQFNLIVFSTEATQWRPSLVPASAENVNKARSFAAGIQALGGT    281 - 350
NINDAMLMAVQLLDSSNQEERLPEGSVSLIILLTDGDPTVGETNPRSIQNNVREAVSGRYSLFCLGFGFD    351 - 420
VSYAFLEKLALDNGGLARRIHEDSDSALQLQDFYQEVANPLLTAVTFEYPSNAVEEVTQNNFRLLFKGSE    421 - 490
MVVAGKLQDRGPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPKYIFHNFMERLWAYLTIQQLLEQT    491 - 560
VSASDADQQALRNQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSGSTFFKYYLQ    561 - 630
GAKIPKPEASFSPRRGWNRQAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPA    631 - 700
TSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVT    701 - 770
GQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDP    771 - 840
DKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRER    841 - 910
RLDYQEGPPGVEISCWSVEL                                                      911 - 930
//

Text Mined References (49)

PMID Year Title
26408095 2015 Serological targeted analysis of an ITIH4 peptide isoform: a preterm birth biomarker and its associated SNP implications.
26206863 2015 Loci with genome-wide associations with schizophrenia in the Han Chinese population.
25977605 2015 Inter-alpha-trypsin inhibitor heavy chain 4: a novel biomarker for environmental exposure to particulate air pollution in patients with chronic obstructive pulmonary disease.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24884609 2014 Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24836184 2014 Inter-alpha-trypsin inhibitor heavy chain H4 as a diagnostic and prognostic indicator in patients with hepatitis B virus-associated hepatocellular carcinoma.
24461634 2014 Association analysis between suicidal behaviour and candidate genes of bipolar disorder and schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
More...