Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.42
PubTator Score 9.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (4)

PMID Text
22076166 Report increased expression of zinc finger protein 267 in non-alcoholic fatty liver disease.
21840307 ZNF267 promotes proliferation and migration of hepatocellular carcinoma cells in vitro
16054593 ZNF267 as a negative transcriptional regulator of matrix metallopeptidase 10 might promote liver fibrogenesis
15814297 The binding site for NF-Y is critical for ZNF267 gene regulation and, herewith, the activation of this transcriptional factor plays an important role in the activation process of hepatic stellate cells and in liver fibrosis

AA Sequence

MGLLTFRDVAVEFSLEEWEHLEPAQKNLYQDVMLENYRNLVSLGLVVSKPDLITFLEQRKEPWNVKSEET      1 - 70
VAIQPDVFSHYNKDLLTEHCTEASFQKVISRRHGSCDLENLHLRKRWKREECEGHNGCYDEKTFKYDQFD     71 - 140
ESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLLNQQEEIDIWGKHHIYDKTSVLFRQVSTLNSYRNVF    141 - 210
IGEKNYHCNNSEKTLNQSSSPKNHQENYFLEKQYKCKEFEEVFLQSMHGQEKQEQSYKCNKCVEVCTQSL    211 - 280
KHIQHQTIHIRENSYSYNKYDKDLSQSSNLRKQIIHNEEKPYKCEKCGDSLNHSLHLTQHQIIPTEEKPC    281 - 350
KWKECGKVFNLNCSLYLTKQQQIDTGENLYKCKACSKSFTRSSNLIVHQRIHTGEKPYKCKECGKAFRCS    351 - 420
SYLTKHKRIHTGEKPYKCKECGKAFNRSSCLTQHQTTHTGEKLYKCKVCSKSYARSSNLIMHQRVHTGEK    421 - 490
PYKCKECGKVFSRSSCLTQHRKIHTGENLYKCKVCAKPFTCFSNLIVHERIHTGEKPYKCKECGKAFPYS    491 - 560
SHLIRHHRIHTGEKPYKCKACSKSFSDSSGLTVHRRTHTGEKPYTCKECGKAFSYSSDVIQHRRIHTGQR    561 - 630
PYKCEECGKAFNYRSYLTTHQRSHTGERPYKCEECGKAFNSRSYLTTHRRRHTGERPYKCDECGKAFSYR    631 - 700
SYLTTHRRSHSGERPYKCEECGKAFNSRSYLIAHQRSHTREKL                               701 - 743
//

Text Mined References (14)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
22076166 2011 Increased expression of zinc finger protein 267 in non-alcoholic fatty liver disease.
21840307 2011 Zinc finger protein 267 is up-regulated in hepatocellular carcinoma and promotes tumor cell proliferation and migration.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16054593 2005 Zinc finger protein 267 is up-regulated during the activation process of human hepatic stellate cells and functions as a negative transcriptional regulator of MMP-10.
15814297 2005 Characterization of the human zinc finger protein 267 promoter: essential role of nuclear factor Y.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...