Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.42
PubTator Score 9.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 3.3e-03
gastric carcinoma 1.200 9.9e-03
intraductal papillary-mucinous carcinoma... 1.200 3.8e-02
intraductal papillary-mucinous neoplasm ... 1.500 4.1e-02
pancreatic cancer 1.100 5.0e-05
primary Sjogren syndrome 1.500 3.2e-04
sarcoidosis 1.800 2.4e-02
tuberculosis -1.900 1.7e-06
ulcerative colitis 1.300 1.4e-04

Gene RIF (4)

AA Sequence

MGLLTFRDVAVEFSLEEWEHLEPAQKNLYQDVMLENYRNLVSLGLVVSKPDLITFLEQRKEPWNVKSEET      1 - 70
VAIQPDVFSHYNKDLLTEHCTEASFQKVISRRHGSCDLENLHLRKRWKREECEGHNGCYDEKTFKYDQFD     71 - 140
ESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLLNQQEEIDIWGKHHIYDKTSVLFRQVSTLNSYRNVF    141 - 210
IGEKNYHCNNSEKTLNQSSSPKNHQENYFLEKQYKCKEFEEVFLQSMHGQEKQEQSYKCNKCVEVCTQSL    211 - 280
KHIQHQTIHIRENSYSYNKYDKDLSQSSNLRKQIIHNEEKPYKCEKCGDSLNHSLHLTQHQIIPTEEKPC    281 - 350
KWKECGKVFNLNCSLYLTKQQQIDTGENLYKCKACSKSFTRSSNLIVHQRIHTGEKPYKCKECGKAFRCS    351 - 420
SYLTKHKRIHTGEKPYKCKECGKAFNRSSCLTQHQTTHTGEKLYKCKVCSKSYARSSNLIMHQRVHTGEK    421 - 490
PYKCKECGKVFSRSSCLTQHRKIHTGENLYKCKVCAKPFTCFSNLIVHERIHTGEKPYKCKECGKAFPYS    491 - 560
SHLIRHHRIHTGEKPYKCKACSKSFSDSSGLTVHRRTHTGEKPYTCKECGKAFSYSSDVIQHRRIHTGQR    561 - 630
PYKCEECGKAFNYRSYLTTHQRSHTGERPYKCEECGKAFNSRSYLTTHRRRHTGERPYKCDECGKAFSYR    631 - 700
SYLTTHRRSHSGERPYKCEECGKAFNSRSYLIAHQRSHTREKL                               701 - 743
//

Text Mined References (15)

PMID Year Title