Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.11
PubTator Score 9.76

Knowledge Summary

Patent (1,626)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.900 8.0e-05
colon cancer -1.500 6.6e-04
glioblastoma 1.400 8.1e-05
group 3 medulloblastoma 1.300 3.1e-04
intraductal papillary-mucinous carcinoma... 1.900 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.0e-02
lung adenocarcinoma 1.500 1.4e-08
non-small cell lung carcinoma 1.200 1.8e-16
psoriasis 1.100 4.3e-02
ulcerative colitis -1.500 4.1e-04

Gene RIF (5)

AA Sequence

MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLR      1 - 70
KCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVC     71 - 140
ESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNNYVIHRNSCEV    141 - 210
EISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYD    211 - 280
SRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLT    281 - 350
GQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL                351 - 408
//

Text Mined References (18)

PMID Year Title