Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $50,761
PubMed Score 6.16
PubTator Score 9.76

Knowledge Summary

Patent (1,626)

Expression

  Differential Expression (10)

Synonym

Accession Q14541 Q7Z2V9 Q9UH81 Q9UIS6 HNF-4-gamma
Symbols NR2A2
NR2A3

Gene

 Grant Application (1)

PDB

1LV2  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (5)

PMID Text
23563607 Single nucleotide polymorphisms in HNF4G gene is associated with obesity.
21047794 Heterodimerization of HNF4alpha and HNF4gamma was found
17684544 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12544512 results suggest that the expression level of dihydrodiol dehydrogenase 4 mRNA is cooperatively regulated by the amounts of HNF-1 alpha, HNF-4 alpha and HNF-4 gamma
12220494 2.7 A X-ray crystalography results suggest that the HNF4s may be transcription factors that are constitutively bound to fatty acids

AA Sequence

MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLR      1 - 70
KCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVC     71 - 140
ESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNNYVIHRNSCEV    141 - 210
EISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYD    211 - 280
SRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLT    281 - 350
GQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL                351 - 408
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
21047794 2011 Proteomic analysis of native hepatocyte nuclear factor-4? (HNF4?) isoforms, phosphorylation status, and interactive cofactors.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17684544 2007 Systematic association mapping identifies NELL1 as a novel IBD disease gene.
16421571 2006 DNA sequence and analysis of human chromosome 8.
More...