Property Summary

NCBI Gene PubMed Count 33
PubMed Score 40.96
PubTator Score 39.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.400 1.3e-06
Breast cancer -2.200 4.6e-08
breast carcinoma -1.300 8.5e-24
colon cancer -3.100 3.4e-04
glioblastoma -1.100 3.7e-02
group 3 medulloblastoma -1.300 1.7e-03
intraductal papillary-mucinous adenoma (... -3.600 5.8e-05
intraductal papillary-mucinous carcinoma... -5.100 3.2e-05
intraductal papillary-mucinous neoplasm ... -4.600 4.2e-04
invasive ductal carcinoma -1.900 1.7e-03
lung adenocarcinoma -1.400 1.0e-09
lung cancer -2.400 5.5e-05
medulloblastoma, large-cell -3.000 1.1e-05
non-small cell lung cancer -1.685 3.1e-17
ovarian cancer -3.700 2.3e-07
pituitary cancer -1.100 2.0e-02
primary Sjogren syndrome 1.600 3.7e-02
primitive neuroectodermal tumor -1.400 2.1e-03
psoriasis -1.200 1.7e-07
ulcerative colitis 1.800 2.8e-04
urothelial carcinoma 2.100 1.2e-02

Gene RIF (20)

AA Sequence

MKTGLFFLCLLGTAAAIPTNARLLSDHSKPTAETVAPDNTAIPSLRAEAEENEKETAVSTEDDSHHKAEK      1 - 70
SSVLKSKEESHEQSAEQGKSSSQELGLKDQEDSDGHLSVNLEYAPTEGTLDIKEDMSEPQEKKLSENTDF     71 - 140
LAPGVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSKHSQGLRDQGNQEQDPNISNGEEEEEKEPGE    141 - 210
VGTHNDNQERKTELPREHANSKQEEDNTQSDDILEESDQPTQVSKMQEDEFDQGNQEQEDNSNAEMEEEN    211 - 280
ASNVNKHIQETEWQSQEGKTGLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGT    281 - 350
DGPRHSASDDYFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTTEPGEHQEAKKAENSSNEEETS    351 - 420
SEGNMRVHAVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKC    421 - 490
RLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYEANSEHAGYLNEKQRNKVKKI    491 - 560
YLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHPMDRVLTHSELAPLRASLVPMEHCITRF    561 - 630
FEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF                                        631 - 664
//

Text Mined References (37)

PMID Year Title