Property Summary

NCBI Gene PubMed Count 28
Grant Count 13
R01 Count 12
Funding $969,303.33
PubMed Score 33.17
PubTator Score 39.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26294211 Androgen-Regulated SPARCL1 in the Tumor Microenvironment Inhibits Metastatic Progression
24661672 radiotherapy causes an increase in SPARCL1 expression; SPARCL1 may have a role in survival in rectal cancer patients
23916135 SPARCL1 expression did not inhibit tumor cell proliferation in vitro. By contrast, SPARCL1 did suppress tumor cell migration and invasiveness in vitro and tumor metastatic growth in vivo, conferring improved survival in xenograft mouse models
22927397 SPARCL1 is a potent regulator of cell migration/invasion and its loss is independently associated with prostate cancer recurrence.
22909274 Sparc-like protein 1 expression correlates with glioma grade, suggesting the possible role for this protein in the progression of this malignancy.
22891198 SPARCL1 functions as a tumor suppressor promoting differentiation possibly via MET, which inhibits the aggressiveness of colorectal cancers
22161898 Down-regulated SPARCL1 is associated with gastric cancer.
21887554 Data suggest that the expression of SPARCL1 protein might be a valuable biomarker for early diagnosis in colorectal cancers and further predicting patients' prognosis.
21528083 Data suggest that SPARCL1, Shp2, MSH2, E-cadherin, p53, ADCY-2 and MAPK are potential prognostic markers in colorectal cancer.
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKTGLFFLCLLGTAAAIPTNARLLSDHSKPTAETVAPDNTAIPSLRAEAEENEKETAVSTEDDSHHKAEK      1 - 70
SSVLKSKEESHEQSAEQGKSSSQELGLKDQEDSDGHLSVNLEYAPTEGTLDIKEDMSEPQEKKLSENTDF     71 - 140
LAPGVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSKHSQGLRDQGNQEQDPNISNGEEEEEKEPGE    141 - 210
VGTHNDNQERKTELPREHANSKQEEDNTQSDDILEESDQPTQVSKMQEDEFDQGNQEQEDNSNAEMEEEN    211 - 280
ASNVNKHIQETEWQSQEGKTGLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGT    281 - 350
DGPRHSASDDYFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTTEPGEHQEAKKAENSSNEEETS    351 - 420
SEGNMRVHAVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKC    421 - 490
RLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYEANSEHAGYLNEKQRNKVKKI    491 - 560
YLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHPMDRVLTHSELAPLRASLVPMEHCITRF    561 - 630
FEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF                                        631 - 664
//

Text Mined References (32)

PMID Year Title
26294211 2015 Androgen-Regulated SPARCL1 in the Tumor Microenvironment Inhibits Metastatic Progression.
24661672 2014 SPARCL1 expression increases with preoperative radiation therapy and predicts better survival in rectal cancer patients.
24121790 2013 A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.
23916135 2013 SPARCL1 suppresses metastasis in prostate cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22927397 2012 Secreted protein, acidic and rich in cysteine-like 1 (SPARCL1) is down regulated in aggressive prostate cancers and is prognostic for poor clinical outcome.
22909274 2012 Sparc-like protein 1 is a new marker of human glioma progression.
22891198 2012 Secreted protein acidic and rich in cysteines-like 1 suppresses aggressiveness and predicts better survival in colorectal cancers.
22161898 2012 Down-regulated SPARCL1 is associated with clinical significance in human gastric cancer.
More...