Property Summary

NCBI Gene PubMed Count 36
PubMed Score 9.80
PubTator Score 26.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.400 3.4e-02
adult high grade glioma 1.500 2.7e-04
astrocytic glioma 1.300 2.0e-02
atypical teratoid / rhabdoid tumor 1.300 1.1e-05
ependymoma 1.800 2.7e-02
intraductal papillary-mucinous adenoma (... 1.500 1.4e-04
intraductal papillary-mucinous carcinoma... 1.500 6.3e-05
juvenile dermatomyositis 1.008 2.4e-05
oligodendroglioma 1.300 3.0e-02
ovarian cancer -1.300 3.0e-07
pancreatic ductal adenocarcinoma liver m... 1.654 7.2e-03
Pick disease 1.600 9.5e-04
psoriasis -1.100 3.1e-08
Rheumatoid arthritis 1.500 4.6e-02

 GO Function (1)

Gene RIF (15)

AA Sequence

MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRE      1 - 70
RKRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE     71 - 140
PIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLA    141 - 210
IGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQ    211 - 280
LMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGID    281 - 350
LGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQP    351 - 420
LATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNA    421 - 490
LHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR                                  491 - 530
//

Text Mined References (49)

PMID Year Title