Property Summary

NCBI Gene PubMed Count 30
PubMed Score 6.33
PubTator Score 26.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 8.03206510805632E-9
psoriasis 6685 3.11049828751483E-8
atypical teratoid / rhabdoid tumor 4369 1.06913294078046E-5
juvenile dermatomyositis 1189 2.38776895359456E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.26596006768048E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.3989245589656E-4
adult high grade glioma 2148 2.73569346726675E-4
Pick disease 1893 9.49503599439954E-4
astrocytic glioma 2241 0.00584914240544266
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00716232940508486
ependymoma 2514 0.0267887150969079
oligodendroglioma 2849 0.0301305244176654
acute myeloid leukemia 785 0.0341797265965141
Rheumatoid Arthritis 1171 0.0455489091538152
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.455 1.7

Expression

Synonym

Accession Q14498 A2RRD3 A5D8W2 B0BLV3 E1P5S0 E1P5S1 Q14499
Symbols HCC1
CAPER
RNPC2
FSAP59
CAPERalpha

Gene

PDB

4OZ1   4OO6   2JRS   2MHN   4OZ0   4YUD  

  Ortholog (9)

Species Source
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 MGI Term (1)

Gene RIF (11)

PMID Text
27018250 mammalian c-Abl plays an important role in steroid hormone receptor-mediated transcription by regulating RBM39
24795046 identify SF3b155 as the relevant ULM-containing partner of full-length CAPERalpha in human cell extracts.
24643682 Our data suggest that overexpression of HCC1/CAPERalpha may increase the proliferation and migration of NSCLC cells, and HCC1/CAPERalpha could be a promising biomarker for lung cancer
24621503 Knockdown of CAPER expression markedly reduced human breast cancer cell proliferation in both in vitro and in vivo settings. Mechanistically, knockdown of CAPER abrogated the activity of proliferative and protein synthesis pathways.
22711543 Data show that CSE1L, DIDO1 and RBM39 mRNA expression levels correlated with chromosome 20q DNA copy number status.
22174317 HIV-1 Rev interacting protein, RNA binding motif protein 39 (RBM39), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with RBM39 is increased by RRE
22009261 Increased VEGF(165) expression is secondary to the down-regulation of CAPER-alpha by EWS/FLI-1. CAPER-alpha mediates alternative splicing and controls the shift from VEGF(189) to VEGF(165) .
19342371 Analysis of human breast cancer samples revealed that CAPER is overexpressed and undergoes a cytoplasmic-to-nuclear shift during the transition from pre-malignancy to ductal carcinoma in situ
18753212 this study identifies CAPERalpha (RNA binding motif protein 39) as a new transcriptional coregulator for v-Rel and reveals an important role in modulating Rel's oncogenic activity.
15747776 10 genes were down-regulated following treatment of the T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h
More...

AA Sequence

MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRE      1 - 70
RKRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE     71 - 140
PIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLA    141 - 210
IGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQ    211 - 280
LMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGID    281 - 350
LGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQP    351 - 420
LATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNA    421 - 490
LHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR                                  491 - 530
//

Text Mined References (42)

PMID Year Title
27018250 2016 Functional interaction between nonreceptor tyrosine kinase c-Abl and SR-Rich protein RBM39.
25416956 2014 A proteome-scale map of the human interactome network.
24795046 2014 Cancer-relevant splicing factor CAPER? engages the essential splicing factor SF3b155 in a specific ternary complex.
24643682 2014 Overexpression of HCC1/CAPER? may play a role in lung cancer carcinogenesis.
24621503 2014 CAPER, a novel regulator of human breast cancer progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22711543 2012 CSE1L, DIDO1 and RBM39 in colorectal adenoma to carcinoma progression.
More...