Property Summary

NCBI Gene PubMed Count 23
Grant Count 1
Funding $111,100.33
PubMed Score 19.71
PubTator Score 21.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.633 0.002
Multiple myeloma 2.241 0.000
ependymoma 1.700 0.013
oligodendroglioma 1.500 0.010
psoriasis 1.100 0.001
osteosarcoma 2.479 0.000
group 4 medulloblastoma 1.800 0.000
astrocytoma 1.100 0.015
glioblastoma 1.400 0.006
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 1.100 0.000
acute quadriplegic myopathy 1.332 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.004
lung cancer 1.400 0.019
breast carcinoma 1.400 0.014
Breast cancer 4.100 0.027
pediatric high grade glioma 1.100 0.009
nasopharyngeal carcinoma 1.100 0.001
lung adenocarcinoma 1.402 0.000
Pick disease -1.100 0.007
ovarian cancer -1.800 0.000
Gaucher disease type 1 -1.100 0.006
pituitary cancer 1.400 0.000
dermatomyositis -1.100 0.000

Synonym

Accession Q14444 A6NMY7 D3DR06 Q15074 Q6IMN4 Q6IMN7 Q9BV09
Symbols M11S1
GPIAP1
RNG105
GPIP137
GRIP137
p137GPI

Gene

PANTHER Protein Class (1)

 Grant Application (1)

PDB

4WBE   4WBP  

Gene RIF (17)

PMID Text
27022092 G3BP mediates the condensation of stress granules by shifting between two different states that are controlled by the phosphorylation of S149 and by binding to Caprin1 or USP10.
25784705 The G3BP1-Caprin1-PKR complex represents a new mode of PKR activation and is important for antiviral activity of G3BP1 and PKR during infection with mengovirus.
25669982 Data show that tylophorine compounds exert anti-cancer activity predominantly by targeting and sequestering the caprin-1 protein and c-Myc mRNA associated ribonucleoprotein complex.
24992036 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
23528710 Cyr61/Caprin-1 co-expression was associated with worse survival.
23125841 Tandem affinity purification and mass spectrometry analysis identify cell cycle associated protein 1 (CAPRIN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cell cycle associated protein 1 (CAPRIN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cell cycle associated protein 1 (CAPRIN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify cell cycle associated protein 1 (CAPRIN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23097442 These results suggest that the Japanese encephalitis virus core protein circumvents translational shutoff by inhibiting stress granule formation through an interaction with Caprin-1 and facilitates viral propagation in vitro and in vivo.
More...

AA Sequence

MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEK      1 - 70
KKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREE     71 - 140
AEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHA    141 - 210
SIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPA    211 - 280
EEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQA    281 - 350
DPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQP    351 - 420
NQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTASSSLPAASQP    421 - 490
QVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQYQASYNQSFSSQPHQVEQTE    491 - 560
LQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPAN    561 - 630
GFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGM    631 - 700
PQMNTQQVN                                                                 701 - 709
//

Text Mined References (34)

PMID Year Title
27022092 2016 G3BP-Caprin1-USP10 complexes mediate stress granule condensation and associate with 40S subunits.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25784705 2015 Stress granules regulate double-stranded RNA-dependent protein kinase activation through a complex containing G3BP1 and Caprin1.
25669982 2015 Targeting a ribonucleoprotein complex containing the caprin-1 protein and the c-Myc mRNA suppresses tumor growth in mice: an identification of a novel oncotarget.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23528710 2013 Caprin-1, a novel Cyr61-interacting protein, promotes osteosarcoma tumor growth and lung metastasis in mice.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097442 2013 Japanese encephalitis virus core protein inhibits stress granule formation through an interaction with Caprin-1 and facilitates viral propagation.
More...