Property Summary

NCBI Gene PubMed Count 11
PubMed Score 176.04
PubTator Score 286.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (2)

AA Sequence

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISSWGMEAYITKE      1 - 70
QKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSD     71 - 140
DYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRM    141 - 210
VQCRSVEGSCGF                                                              211 - 222
//

Text Mined References (13)

PMID Year Title