Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 1
Funding $186,415.77
PubMed Score 161.41
PubTator Score 286.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISSWGMEAYITKE      1 - 70
QKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSD     71 - 140
DYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRM    141 - 210
VQCRSVEGSCGF                                                              211 - 222
//

Text Mined References (13)

PMID Year Title
26862561 2016 Curated eutherian third party data gene data sets.
26697363 2015 Third party data gene data set of eutherian growth hormone genes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8083227 1994 Complex alternative splicing partially inactivates the human chorionic somatomammotropin-like (hCS-L) gene.
3030680 1987 The human growth hormone gene locus: structure, evolution, and allelic variations.
More...