Property Summary

NCBI Gene PubMed Count 129
Grant Count 61
R01 Count 30
Funding $4,344,952.02
PubMed Score 294.94
PubTator Score 235.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14393 B3KRQ7 B3KVL4 E9PBL7 Q6IMN1 Q7Z7N3 GAS-6
Symbols AXSF
AXLLG

Gene

PANTHER Protein Class (1)

PDB

2C5D   4RA0   1H30  

Gene RIF (110)

PMID Text
27006397 Gas6-mediated uptake is not a means to clear the bulk of circulating membrane-derived microparticles (PMPs) but may serve to locally phagocytose PMPs generated at sites of platelet activation and as a way to effect endothelial responses.
26445266 decreased plasma Gas6 concentration and labial salivary gland expression were associated with primary Sjogren syndrome(pSS); Gas6 may represent a novel independent risk factor for pSS, with a potential role in salivary gland inflammation and dysfunction
26415371 a protective role for AA Gas6 variant in type 2 diabetic patients may be concluded
26350366 High expression of Gas6 correlated with Upper Tract Urothelial Carcinoma.
26284522 Gas6 gene variants are associated with IR, although their effects on subsequent progression to T2D were minimal in this prospective Asian cohort
26207647 Gas6 increases the metastatic capacity of oral squamous cell carcinoma(OSCC) cells and serum Gas6 could be a candidate biomarker for diagnostic and prognostic use in OSCC patients.
26206560 Gas6-induced Axl signaling is a critical driver of pancreatic cancer progression.
25957430 Data shoed increased GAS6 and decreased MGP levels in hemodialysis patients, as mediators of induction or prevention of vascular calcification.
25908269 Gas6 and Axl serum levels increase in parallel to chronic liver disease progression inactivation.
25869052 GAS6 intron 8 c.834 + 7G > A polymorphism was not associated with diabetic nephropathy in type 2 diabetes mellitus. However, heterozygous state of this polymorphism may be a risk factor for diabetic retinopathy in patients with diabetic nephropathy.
More...

AA Sequence

MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHLERECVEELC      1 - 70
SREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNF     71 - 140
FCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEA    141 - 210
RCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCELE    211 - 280
AGWPCPRHRRDGSPAARPGRGAQGSRSEGHIPDRRGPRPWQDILPCVPFSVAKSVKSLYLGRMFSGTPVI    281 - 350
RLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLRYNGVGRVTSSGPVINHG    351 - 420
MWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLNLTVGGIPFHEKDLVQPINPRLDGCMRS    421 - 490
WNWLNGEDTTIQETVKVNTRMQCFSVTERGSFYPGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAA    491 - 560
DTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEAT    561 - 630
LEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDE    631 - 700
AAYKHSDITAHSCPPVEPAAA                                                     701 - 721
//

Text Mined References (134)

PMID Year Title
27006397 2016 The Gas6-Axl Protein Interaction Mediates Endothelial Uptake of Platelet Microparticles.
26445266 2015 Growth Arrest-Specific 6 Protein in Patients with Sjögren Syndrome: Determination of the Plasma Level and Expression in the Labial Salivary Gland.
26415371 2015 Serum Level of Growth Arrest-Specific 6 (Gas6) Protein and Genetic Variations in the Gas6 Gene in Patients with Type 2 Diabetes Mellitus.
26350366 2016 Relationship Between Increased Expression of the Axl/Gas6 Signal Cascade and Prognosis of Patients with Upper Tract Urothelial Carcinoma.
26284522 2015 Effect of Common Genetic Variants of Growth Arrest-Specific 6 Gene on Insulin Resistance, Obesity and Type 2 Diabetes in an Asian Population.
26207647 2015 Elevated Serum Gas6 Is a Novel Prognostic Biomarker in Patients with Oral Squamous Cell Carcinoma.
26206560 2015 Warfarin Blocks Gas6-Mediated Axl Activation Required for Pancreatic Cancer Epithelial Plasticity and Metastasis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25957430 2015 Growth Arrest-specific 6 Protein and Matrix Gla Protein in Hemodialysis Patients.
25908269 2015 Gas6/Axl pathway is activated in chronic liver disease and its targeting reduces fibrosis via hepatic stellate cell inactivation.
More...