Property Summary

NCBI Gene PubMed Count 146
PubMed Score 322.06
PubTator Score 235.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.025 2.1e-03
Astrocytoma, Pilocytic -1.100 3.5e-06
Breast cancer -1.300 6.2e-06
cystic fibrosis 1.483 1.1e-04
glioblastoma -1.100 1.6e-05
group 3 medulloblastoma -1.300 1.1e-03
intraductal papillary-mucinous adenoma (... -1.100 4.8e-03
intraductal papillary-mucinous carcinoma... -1.100 1.9e-02
intraductal papillary-mucinous neoplasm ... -1.300 5.2e-03
invasive ductal carcinoma -1.300 8.4e-04
lung adenocarcinoma -2.000 2.7e-10
lung cancer -1.200 1.3e-03
lung carcinoma -1.900 2.9e-23
medulloblastoma, large-cell -2.000 3.0e-05
non-small cell lung cancer -1.553 3.9e-22
ovarian cancer -1.500 1.6e-04
pediatric high grade glioma -1.100 2.5e-04
primary pancreatic ductal adenocarcinoma 1.032 2.7e-02
psoriasis 1.400 1.0e-04

Protein-protein Interaction (1)

Gene RIF (127)

AA Sequence

MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHLERECVEELC      1 - 70
SREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNF     71 - 140
FCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEA    141 - 210
RCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCELE    211 - 280
AGWPCPRHRRDGSPAARPGRGAQGSRSEGHIPDRRGPRPWQDILPCVPFSVAKSVKSLYLGRMFSGTPVI    281 - 350
RLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLRYNGVGRVTSSGPVINHG    351 - 420
MWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLNLTVGGIPFHEKDLVQPINPRLDGCMRS    421 - 490
WNWLNGEDTTIQETVKVNTRMQCFSVTERGSFYPGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAA    491 - 560
DTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEAT    561 - 630
LEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDE    631 - 700
AAYKHSDITAHSCPPVEPAAA                                                     701 - 721
//

Text Mined References (151)

PMID Year Title