Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
Funding $1,022,721
PubMed Score 20.65
PubTator Score 11.38

Knowledge Summary

Patent (1,367)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.500 0.000
lung adenocarcinoma 1.300 0.000

Gene RIF (8)

PMID Text
25704814 FASTK binds at multiple sites along the ND6 mRNA and its precursors and cooperates with the mitochondrial degradosome to ensure regulated ND6 mRNA biogenesis.
24013584 MIR-106a-5p functions as a tumor suppressor during the development of astrocytomas by targeting FASTK.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20363972 FAST expression on lung cells of hematopoietic origin is crucial in mediating lipopolysaccharide-induced neutrophil migration to the lung in transgenic FAST-deficient mice compared with wild type controls.
19058789 Observational study of gene-disease association. (HuGE Navigator)
17592127 Nuclear FAST can regulate the splicing of FGFR2 transcripts.
17135269 FAST K synergizes with TIA-1/TIAR proteins to regulate Fas alternative splicing
15572676 FAST is a survival protein that senses mitochondrial stress and modulates TIA-1 regulated changes in protein expression.

AA Sequence

MRRPRGEPGPRAPRPTEGATCAGPGESWSPSPNSMLRVLLSAQTSPARLSGLLLIPPVQPCCLGPSKWGD      1 - 70
RPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQ     71 - 140
DLSQLIIRNCPSFDIHTIHVCLHLAVLLGFPSDGPLVCALEQERRLRLPPKPPPPLQPLLRGGQGLEAAL    141 - 210
SCPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKL    211 - 280
VLPFGRLNYLPLEQQFMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPH    281 - 350
ALIVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQ    351 - 420
DLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRD    421 - 490
GRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG               491 - 549
//

Text Mined References (24)

PMID Year Title
25704814 2015 A mitochondria-specific isoform of FASTK is present in mitochondrial RNA granules and regulates gene expression and function.
25416956 2014 A proteome-scale map of the human interactome network.
24013584 2013 miR-106a-5p inhibits the proliferation and migration of astrocytoma cells and promotes apoptosis by targeting FASTK.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20363972 2010 Fas-activated serine/threonine phosphoprotein promotes immune-mediated pulmonary inflammation.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
17592127 2007 Fas-activated serine/threonine phosphoprotein (FAST) is a regulator of alternative splicing.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17135269 2007 Fas-activated serine/threonine kinase (FAST K) synergizes with TIA-1/TIAR proteins to regulate Fas alternative splicing.
More...