Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.92
PubTator Score 11.38

Knowledge Summary

Patent (1,367)

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 4.2e-12
psoriasis 6694 1.4e-04
Disease Target Count Z-score Confidence
Episodic ataxia type 1 4 3.599 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.300 4.2e-12
psoriasis 1.500 1.4e-04

Gene RIF (8)

AA Sequence

MRRPRGEPGPRAPRPTEGATCAGPGESWSPSPNSMLRVLLSAQTSPARLSGLLLIPPVQPCCLGPSKWGD      1 - 70
RPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQ     71 - 140
DLSQLIIRNCPSFDIHTIHVCLHLAVLLGFPSDGPLVCALEQERRLRLPPKPPPPLQPLLRGGQGLEAAL    141 - 210
SCPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKL    211 - 280
VLPFGRLNYLPLEQQFMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPH    281 - 350
ALIVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQ    351 - 420
DLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRD    421 - 490
GRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG               491 - 549
//

Text Mined References (25)

PMID Year Title