Property Summary

NCBI Gene PubMed Count 79
PubMed Score 91.07
PubTator Score 77.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 5.5e-09
malignant mesothelioma 3232 1.3e-06
osteosarcoma 7950 9.0e-04
COPD 118 3.1e-03
Disease Target Count Z-score Confidence
Toxic megacolon 6 3.062 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
COPD -1.100 3.1e-03
malignant mesothelioma -1.500 1.3e-06
osteosarcoma -1.734 9.0e-04
tuberculosis 1.200 5.5e-09

 IMPC Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (52)

AA Sequence

MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT      1 - 70
GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAP     71 - 140
DVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADT    141 - 210
KIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDK    211 - 280
ELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQK    281 - 350
YGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI    351 - 420
KKATGVQV                                                                  421 - 428
//

Text Mined References (83)

PMID Year Title