Property Summary

NCBI Gene PubMed Count 73
Grant Count 11
R01 Count 7
Funding $513,283.32
PubMed Score 83.45
PubTator Score 77.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
osteosarcoma -1.734 0.001
tuberculosis 1.200 0.000
COPD -1.100 0.003

Gene RIF (46)

PMID Text
26576674 that miR-449a suppressed Flot2 expression results in decreased cell invasion through repressing TGF-beta-mediated-epithelial-mesenchymal transition
26556629 There was a strong association between polymorphisms of flotillin-2 gene and CAD in the Chinese Han population
26339392 Positive expression of Flot-2 protein may be an independent biomarker for poor prognosis in oral squamous cell carcinoma.
26206082 Flot-2 exerts a pro-neoplastic role in NPC and is involved in tumor progression and metastasis. Moreover, Flot-2 exerts its role through NF-kappaB and PI3K/Akt3 signaling.
26161893 increased expression of Flot-2 and EGFR in non-small cell lung cancer patients is inversely proportional to the disease prognosis.
25909165 Flot2 is an indispensable member for TGF-beta signaling, which is essential for the epithelial-mesenchymal transition process in nasopharyngeal carcinoma metastasis
25755754 FLOT2 may serve as an oncogene in the development of cervical cancer
25755751 Our findings provided that high FLOT2 expression was associated with poor outcomes in non-small cell lung cancer patients
25738752 Knockdown of FLOT2 decreases breast cancer cell proliferation. Silencing of FLOT2 enhanced the transcriptional activity of FOXO factors by decreasing its phosphorylation through inhibiting the PI3K/Akt signaling pathway.
25403318 Flotillin 2 (FLOT2) is a direct target of microRNA-34a and the miR-34a/FLOT2 pathway plays a key role in melanoma proliferation and metastasis.
More...

AA Sequence

MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT      1 - 70
GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAP     71 - 140
DVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADT    141 - 210
KIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDK    211 - 280
ELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQK    281 - 350
YGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI    351 - 420
KKATGVQV                                                                  421 - 428
//

Text Mined References (77)

PMID Year Title
26576674 2015 miR-449a targets Flot2 and inhibits gastric cancer invasion by inhibiting TGF-?-mediated EMT.
26556629 2015 Flotillin-2 Gene Is Associated with Coronary Artery Disease in Chinese Han Population.
26339392 2015 FLOT-2 is an independent prognostic marker in oral squamous cell carcinoma.
26206082 2015 Flotillin-2 promotes metastasis of nasopharyngeal carcinoma by activating NF-?B and PI3K/Akt3 signaling pathways.
26161893 2015 Flot-2 Expression Correlates with EGFR Levels and Poor Prognosis in Surgically Resected Non-Small Cell Lung Cancer.
25909165 2015 Flotillin-2 promotes nasopharyngeal carcinoma metastasis and is necessary for the epithelial-mesenchymal transition induced by transforming growth factor-?.
25755754 2015 High expression of flotillin-2 is associated with poor clinical survival in cervical carcinoma.
25755751 2015 Expression of flotillin-2 in human non-small cell lung cancer and its correlation with tumor progression and patient survival.
25738752 2015 Knockdown of flotillin-2 impairs the proliferation of breast cancer cells through modulation of Akt/FOXO signaling.
25403318 2015 Identification of FLOT2 as a novel target for microRNA-34a in melanoma.
More...