Property Summary

NCBI Gene PubMed Count 49
PubMed Score 6.31
PubTator Score 40.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.5e-33
malignant mesothelioma 3232 9.0e-06
osteosarcoma 7950 1.2e-03
interstitial cystitis 2312 3.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis 1.100 3.2e-02
malignant mesothelioma 1.400 9.0e-06
osteosarcoma -1.092 1.2e-03
psoriasis 1.600 4.5e-33

Synonym

Accession Q14213 A0N0N2 O75269 IL-27 subunit beta
Symbols IL27B
IL35B
IL-27B

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (8)

Gene RIF (40)

AA Sequence

MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGM      1 - 70
AARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPL     71 - 140
AERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTD    141 - 210
YGELSDWSLPATATMSLGK                                                       211 - 229
//

Text Mined References (50)

PMID Year Title