Property Summary

NCBI Gene PubMed Count 43
PubMed Score 5.57
PubTator Score 40.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.092 0.001
interstitial cystitis 1.100 0.032
psoriasis 1.600 0.000

Gene RIF (35)

PMID Text
26472010 higher decidual mRNA expression in preeclampsia
26431888 IL-35 was elevated in bone marrow of adult AML patients and this increase was correlated with the clinical stages of malignancy, suggesting that IL-35 is involved in pathogenesis of AML.
26355156 EBI3 Downregulation Contributes to Type I Collagen Overexpression in Scleroderma Skin.
26303210 Data suggest that the toll like receptor 3 (TLR3)-interferon regulatory factor 6 protein (IRF6)-interleukin-23 subunit p19 (p19)/EBI3 protein axis may regulate keratinocyte functions in the skin.
26204444 Elevated circulating IL-35, particularly at early phase, its decrease after treatment initiation, and a positive association between synovial fluid IL-35 and disease activity support an involvement of IL-35 in the pathogenesis of RA.
26116899 HIV-1 Vpr downregulates the expression of EBI3 in human monocyte-derived dendritic cells
26044961 IL-35 can effectively suppress the proliferation and IL-4 production of activated CD4+CD25- T cells in allergic asthma, and that IL-35 may be a new immunotherapy for asthma patients.
25937126 EBI3 gene rs4740 polymorphism is closely associated with susceptibility to pulmonary tuberculosis and the elevation and enrichment of EBI3 in the lung derived from macrophages may contribute to the exacerbation of mycobacterial infection.
25935866 IL-35 mRNA and protein were higher in tuberculous pleural effusions than in malignant ones.
25869609 IL-35 is highly expressed in chronic HBV CD4(+) T-cells and plays an important role in the inhibition of the cellular immune response in chronic HBV.
More...

AA Sequence

MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGM      1 - 70
AARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPL     71 - 140
AERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTD    141 - 210
YGELSDWSLPATATMSLGK                                                       211 - 229
//

Text Mined References (44)

PMID Year Title
26472010 2016 Higher decidual EBI3 and HLA-G mRNA expression in preeclampsia: Cause or consequence of preeclampsia.
26431888 2015 Elevated IL-35 in bone marrow of the patients with acute myeloid leukemia.
26355156 2015 EBI3 Downregulation Contributes to Type I Collagen Overexpression in Scleroderma Skin.
26303210 2015 TLR3 drives IRF6-dependent IL-23p19 expression and p19/EBI3 heterodimer formation in keratinocytes.
26204444 2015 Interleukin 35 Synovial Fluid Levels Are Associated with Disease Activity of Rheumatoid Arthritis.
26044961 2015 A potential immunopathogenic role for reduced IL-35 expression in allergic asthma.
25937126 2015 Epstein-Barr virus-induced gene 3 (EBI3) polymorphisms and expression are associated with susceptibility to pulmonary tuberculosis.
25935866 2015 High IL-35 pleural expression in patients with tuberculous pleural effusion.
25869609 2015 IL-35 inhibits HBV antigen-specific IFN-?-producing CTLs in vitro.
25640666 2015 Interleukin 35 may contribute to the loss of immunological self-tolerance in patients with primary immune thrombocytopenia.
More...