Property Summary

NCBI Gene PubMed Count 28
PubMed Score 4.35
PubTator Score 66.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.500 0.001
osteosarcoma -2.998 0.000
sonic hedgehog group medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor 1.500 0.001
glioblastoma 1.200 0.006
primitive neuroectodermal tumor 1.200 0.025
Atopic dermatitis -1.100 0.000
non-small cell lung cancer 1.683 0.000
lung cancer 1.900 0.004
invasive ductal carcinoma -1.400 0.016
Pick disease 1.300 0.000
ovarian cancer -1.400 0.000
cystic fibrosis and chronic rhinosinusit... 1.356 0.035

Gene

PANTHER Protein Class (1)

PDB

1CF7  

Gene RIF (6)

PMID Text
26503584 GAB2, GSPT1, TFDP2 and ZFPM1 are four new susceptibility loci for testicular germ cell tumor.
25312757 DP2 is expressed by the bronchial epithelium, and its activation drives epithelial differentiation, suggesting that in addition to its well-characterized role in inflammatory cell migration, DP2 might contribute to airway remodeling in asthmatic patients.
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of transcription factor Dp-2 (E2F dimerization partner 2; TFDP2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
8755520 This study demonstrates translation from an internal methionine.

AA Sequence

MTAKNVGLTSTNAEVRGFIDQNLSPTKGNISFVAFPVSNTNSPTKILPKTLGPINVNVGPQMIISTPQRL      1 - 70
TSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESKRSKKGDKNGKGLRHFSMKVC     71 - 140
EKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLP    141 - 210
TNSAQECQNLEIEKQRRIERIKQKRAQLQELLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIIN    211 - 280
TSRKTVIDCSISSDKFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYIT    281 - 350
DISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCS    351 - 420
ESRGETPCSFNDEDEEDDEEDSSSPE                                                421 - 446
//

Text Mined References (35)

PMID Year Title
26503584 2015 Identification of four new susceptibility loci for testicular germ cell tumour.
25416956 2014 A proteome-scale map of the human interactome network.
25312757 2015 D prostanoid receptor 2 (chemoattractant receptor-homologous molecule expressed on TH2 cells) protein expression in asthmatic patients and its effects on bronchial epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22810586 2012 Interpreting cancer genomes using systematic host network perturbations by tumour virus proteins.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20176812 2010 Repression of transcriptional activity of C/EBPalpha by E2F-dimerization partner complexes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...