Property Summary

NCBI Gene PubMed Count 29
PubMed Score 4.94
PubTator Score 66.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis -1.100 3.8e-04
atypical teratoid / rhabdoid tumor 1.500 6.6e-04
cystic fibrosis and chronic rhinosinusit... 1.356 3.5e-02
glioblastoma 1.200 6.4e-03
group 3 medulloblastoma 1.100 6.5e-04
invasive ductal carcinoma -1.018 1.1e-05
lung cancer 1.900 3.8e-03
non-small cell lung cancer 1.683 8.5e-19
osteosarcoma -2.641 5.2e-05
ovarian cancer -1.400 6.7e-08
Pick disease 1.300 2.6e-05
primitive neuroectodermal tumor 1.200 2.5e-02
psoriasis -1.500 7.2e-04

Protein-protein Interaction (8)

Gene RIF (6)

AA Sequence

MTAKNVGLTSTNAEVRGFIDQNLSPTKGNISFVAFPVSNTNSPTKILPKTLGPINVNVGPQMIISTPQRL      1 - 70
TSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESKRSKKGDKNGKGLRHFSMKVC     71 - 140
EKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLP    141 - 210
TNSAQECQNLEIEKQRRIERIKQKRAQLQELLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIIN    211 - 280
TSRKTVIDCSISSDKFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYIT    281 - 350
DISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCS    351 - 420
ESRGETPCSFNDEDEEDDEEDSSSPE                                                421 - 446
//

Text Mined References (36)

PMID Year Title