Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.21
PubTator Score 7.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 2.1e-05
Astrocytoma, Pilocytic -1.300 4.8e-09
atypical teratoid / rhabdoid tumor -1.400 1.3e-07
ependymoma -1.400 9.5e-14
glioblastoma -1.100 5.2e-07
lung carcinoma 1.200 1.9e-33
medulloblastoma -1.200 5.7e-05
medulloblastoma, large-cell -1.100 1.4e-03
osteosarcoma 2.325 1.3e-07
ovarian cancer -1.100 1.3e-04
pituitary cancer 1.400 9.0e-07
subependymal giant cell astrocytoma -1.893 2.2e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MPVAATNSETAMQQVLDNLGSLPSATGAAELDLIFLRGIMESPIVRSLAKVIMVLWFMQQNVFVPMKYML      1 - 70
KYFGAHERLEETKLEAVRDNNLELVQEILRDLAHVAEQSSTAAELAHILQEPHFQSLLETHDSVASKTYE     71 - 140
TPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIK    141 - 210
EVNGQPVGSDPRALQELLRNASGSVILKILPSYQEPHLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAG    211 - 280
DLLQIVNQDDANWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTT    281 - 350
KNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREG    351 - 420
QGYSFVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVV    421 - 490
FIEAPDFETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAM    491 - 560
EKLRTEPQWVPVSWVY                                                          561 - 576
//

Text Mined References (16)

PMID Year Title