Property Summary

NCBI Gene PubMed Count 35
PubMed Score 35.49
PubTator Score 19.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.85660486953256E-12
malignant mesothelioma 3163 2.97936081399486E-6
osteosarcoma 7933 2.79358952888984E-5
medulloblastoma, large-cell 6234 6.7703385655889E-4
primary Sjogren syndrome 789 0.00251257014091656
Waldenstrons macroglobulinemia 765 0.00396582102347098
Disease Target Count Z-score Confidence
Systemic scleroderma 66 4.464 2.2
Constipation 43 3.47 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.098 0.004
malignant mesothelioma 1.200 0.000
osteosarcoma -2.422 0.000
medulloblastoma, large-cell -1.300 0.001
primary Sjogren syndrome 1.100 0.003
ovarian cancer -2.000 0.000

Synonym

Accession Q14161 Q86U59 Q96CI2 Q9BV91 Q9Y5V2 ARF GAP GIT2
Symbols PKL
CAT2
CAT-2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (8)

PMID Text
25605334 GIT2 plays an important role in MRE11/ATM/H2AX-mediated DNA damage responses.
23864433 ADMA and L-arginine are substrates of human CAT2A, CAT2B, OCT2 and MATE1. Transport kinetics of CAT2A, CAT2B, and OCT2 indicate a low affinity, high capacity transport, which may be relevant for renal and hepatic elimination of ADMA or L-arginine
23591815 Zeb1 is regulated by the Arf GTPase-activating protein (GAP) Git2.
16628223 These results suggest that inactivation of GIT2 function is a required step for induction of cell motility and that GIT2 may be a target of oncogenic signaling pathways that regulate cell migration.
16598076 GTI proteins regulate cytoskeletal dynamics by feedback inhibition of Rac1, they participate in receptor internalization by regulating membrane trafficking between
16501306 The expression level of lymphocyte GRK might show the severity of CHF, and ACEI treatment could reduce the level of GRK in CHF patients.
15212761 GIT2 protein is tightly associated with PIX family Rac1/Cdc42 guanine nucleotide exchange factors as a multimeric nexus capable of linking together important signaling molecules.
11251077 Git2-short, weakly interacting with paxillin, functions in the regulation of Golgi organization, actin cytoskeletal organization, and subcellular localization of paxillin, important in integrin-mediated cell adhesion and intracellular signaling.

AA Sequence

MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNN      1 - 70
GANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSS     71 - 140
VRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQG    141 - 210
GHHELAERLVEIQYELTDRLAFYLCGRKPDHKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEE    211 - 280
LAMDVYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDIL    281 - 350
SDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL    351 - 420
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQATTNVYQVQTGS    421 - 490
EYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHIGRSALVTSSSSL    491 - 560
PSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPH    561 - 630
VAPSPTLPSTEDVIRKTEQITKNIQELLRAAQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSL    631 - 700
RLLTSSAYRLQSECKKTLPGDPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN               701 - 759
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25605334 2015 Nuclear GIT2 is an ATM substrate and promotes DNA repair.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23864433 2013 Transport of asymmetric dimethylarginine (ADMA) by cationic amino acid transporter 2 (CAT2), organic cation transporter 2 (OCT2) and multidrug and toxin extrusion protein 1 (MATE1).
23591815 2013 Loss of Git2 induces epithelial-mesenchymal transition by miR146a-Cnot6L-controlled expression of Zeb1.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23285027 2012 Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22728435 2012 Identification of paxillin domains interacting with ?-catenin.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...