Property Summary

NCBI Gene PubMed Count 78
PubMed Score 240.55
PubTator Score 115.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.1
Disease Target Count Z-score Confidence
Epilepsy 792 3.201 1.6

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.573 2.7e-05
aldosterone-producing adenoma -1.563 4.9e-02
astrocytic glioma 1.500 2.4e-02
Astrocytoma, Pilocytic 1.200 2.4e-06
atypical teratoid / rhabdoid tumor 1.500 8.8e-04
Down syndrome 2.200 5.9e-04
ependymoma 1.500 1.8e-02
Gaucher disease type 1 -1.200 3.6e-02
glioblastoma 2.100 1.2e-04
group 3 medulloblastoma 1.700 3.7e-04
hereditary spastic paraplegia -1.399 3.6e-03
juvenile dermatomyositis 1.046 1.0e-09
lung adenocarcinoma 1.487 2.1e-04
malignant mesothelioma -1.800 1.4e-06
medulloblastoma, large-cell 1.800 1.2e-04
oligodendroglioma 2.400 1.4e-03
osteosarcoma 1.793 3.8e-03
ovarian cancer -1.900 4.9e-07
pediatric high grade glioma 1.500 2.0e-03
Pick disease -1.300 4.9e-03
Polycystic ovary syndrome -1.191 1.3e-02
primitive neuroectodermal tumor 1.100 4.5e-04
progressive supranuclear palsy -1.500 1.6e-02
psoriasis -2.100 3.2e-04

Protein-protein Interaction (3)

Gene RIF (55)

AA Sequence

MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVT      1 - 70
NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPV     71 - 140
LTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDISPYFGLFYEKNGTND    141 - 210
GDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYIT    211 - 280
FSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFV    281 - 350
SAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKE    351 - 420
TASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPLIRT                421 - 478
//

Text Mined References (85)

PMID Year Title