Property Summary

NCBI Gene PubMed Count 74
PubMed Score 226.39
PubTator Score 115.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
ovarian cancer 8492 2.64038428328105E-11
juvenile dermatomyositis 1189 1.03847387215859E-9
malignant mesothelioma 3163 1.51760904947185E-6
medulloblastoma, large-cell 6234 4.18745756116811E-6
group 4 medulloblastoma 1875 1.41440352221089E-5
acute quadriplegic myopathy 1157 5.28957648756697E-5
pilocytic astrocytoma 3086 1.02868232966618E-4
glioblastoma 5572 1.18387767315301E-4
lung adenocarcinoma 2714 2.14054114612609E-4
psoriasis 6685 3.15372224397827E-4
primitive neuroectodermal tumor 3031 4.45535659678637E-4
Down syndrome 548 5.90637309357283E-4
osteosarcoma 7933 5.98515783949374E-4
atypical teratoid / rhabdoid tumor 4369 8.7684269185086E-4
oligodendroglioma 2849 0.00135816061979329
pediatric high grade glioma 2712 0.00196407259696802
hereditary spastic paraplegia 313 0.00361743942776239
Pick disease 1893 0.00492317219490015
Polycystic Ovary Syndrome 335 0.0125672288984185
progressive supranuclear palsy 674 0.0137522969205726
ependymoma 2514 0.0181844203178522
astrocytic glioma 2241 0.0241938475590166
Gaucher disease type 1 171 0.0358096341394314
aldosterone-producing adenoma 664 0.0489832902949037
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Epilepsy 346 3.24 1.6

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
astrocytic glioma 1.500 0.024
ependymoma 1.500 0.018
oligodendroglioma 2.400 0.001
psoriasis -2.100 0.000
osteosarcoma 2.183 0.001
group 4 medulloblastoma 2.900 0.000
atypical teratoid / rhabdoid tumor 1.500 0.001
glioblastoma 2.100 0.000
medulloblastoma, large-cell 3.000 0.000
primitive neuroectodermal tumor 1.100 0.000
hereditary spastic paraplegia -1.399 0.004
acute quadriplegic myopathy 1.820 0.000
juvenile dermatomyositis 1.046 0.000
pediatric high grade glioma 1.500 0.002
pilocytic astrocytoma 1.600 0.000
aldosterone-producing adenoma -1.563 0.049
lung adenocarcinoma 1.487 0.000
Polycystic Ovary Syndrome -1.191 0.013
Pick disease -1.300 0.005
progressive supranuclear palsy -1.600 0.014
ovarian cancer -3.100 0.000
Gaucher disease type 1 -1.200 0.036
Down syndrome 2.200 0.001

Synonym

Accession Q14108 B4DKD8 E7EM68 Q53Y63
Symbols AMRF
EPM4
LGP85
CD36L2
HLGP85
LIMP-2
LIMPII
SR-BII

Gene

PANTHER Protein Class (1)

PDB

4F7B   4Q4B   4Q4F   4TVZ   4TW0   4TW2  

  Ortholog (13)

 GWAS Trait (1)

Gene RIF (51)

PMID Text
26936883 hSR-BII, and to a lesser extent hSR-BI, significantly increase LPS-induced inflammation and contribute to LPS-induced tissue injury in the liver and kidney, two major organs susceptible to LPS toxicity.
26304790 LIMPII was increased greater than twofold in urinary microvesicles obtained from patients with idiopathic membranous nephropathy compared to microvesicles of patients with idiopathic focal segmental glomerulosclerosis and normal controls.
26224037 Findings suggested that STX1B rs4889603, FAM47E rs6812193 and SCARB2 rs6825004 do not confer a significant risk for Parkinson's disease
26018676 Although hrGCase cellular uptake is independent of LIMP-2, its trafficking to the lysosomes is mediated by this receptor.
25862818 SCARB2 regulates TLR9-dependent IFN-I production of plasmacytoid dendritic cells
25576872 Disease-causing cathepsin-F mutants fail to cleave LIMP-2. Our findings provide evidence that LIMP-2 represents an in vivo substrate of cathepsin-F with relevance for understanding the pathophysiology of type-B-Kufs-disease.
25316793 In LIMP-2-deficient brains a significant reduction in GC activity led to lipid storage, disturbed autophagic/lysosomal function, and alpha-synuclein accumulation.
25202012 The LIMP-2/SCARB2 binding sequences for enterovirus 71 and GCase are not similar, indicating that LIMP-2/SCARB2 may have multiple or overlapping binding sites with differing specificities.
24997419 SCARB2 and PSGL-1 in human gastrointestinal tract, lung, and brain tissues correlated with the distribution of pathological changes seen in EV71 infection.
24986489 Data indicate that scavenger receptor SCARB2 triggers uncoating of human enterovirus 71 (EV71) under low pH conditions.
More...

AA Sequence

MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVT      1 - 70
NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPV     71 - 140
LTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDISPYFGLFYEKNGTND    141 - 210
GDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYIT    211 - 280
FSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFV    281 - 350
SAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKE    351 - 420
TASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPLIRT                421 - 478
//

Text Mined References (81)

PMID Year Title
26936883 2016 Human SR-BI and SR-BII Potentiate Lipopolysaccharide-Induced Inflammation and Acute Liver and Kidney Injury in Mice.
26304790 2015 Increased expression of lysosome membrane protein 2 in glomeruli of patients with idiopathic membranous nephropathy.
26224037 2015 No association of FAM47E rs6812193, SCARB2 rs6825004 and STX1B rs4889603 polymorphisms with Parkinson's disease in a Chinese Han population.
26018676 2015 Role of LIMP-2 in the intracellular trafficking of ?-glucosidase in different human cellular models.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862818 2015 SCARB2/LIMP-2 Regulates IFN Production of Plasmacytoid Dendritic Cells by Mediating Endosomal Translocation of TLR9 and Nuclear Translocation of IRF7.
25576872 2015 Lysosomal integral membrane protein type-2 (LIMP-2/SCARB2) is a substrate of cathepsin-F, a cysteine protease mutated in type-B-Kufs-disease.
25316793 2014 LIMP-2 expression is critical for ?-glucocerebrosidase activity and ?-synuclein clearance.
25202012 2014 The LIMP-2/SCARB2 binding motif on acid ?-glucosidase: basic and applied implications for Gaucher disease and associated neurodegenerative diseases.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
More...