Property Summary

NCBI Gene PubMed Count 44
Grant Count 34
R01 Count 26
Funding $4,753,749.87
PubMed Score 121.18
PubTator Score 55.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.300 0.000
non-small cell lung cancer 1.406 0.000
lung cancer 1.900 0.000
ovarian cancer 1.300 0.000

 GWAS Trait (1)

Gene RIF (20)

PMID Text
26497677 Eribulin binding to the tip of microtubules and subsequent loss of ch-TOG is a priming event leading to alterations in microtubule dynamics and breast cancer cell migration.
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with microtubule- associated protein TPX2.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that CKAP5 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with CKAP5
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that CKAP5 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with CKAP5
24273164 Aurora-A kinase does not regulate TACC3-chTOG complex formation, indicating that Aurora-A solely functions as a recruitment factor for the TACC3-chTOG complex to centrosomes and proximal mitotic spindles.
23444224 Data show that five genes CKAP5, KPNB1, RAN, TPX2 and KIF11 were shown to be essential for tumor cell survival in both head and neck squamous cell carcinoma (HNSCC)and non-small cell lung cancer (NSCLC), but most particularly in HNSCC.
23251535 These observations indicate that EB1 and ch-TOG regulate microtubule organisation differently via distinct regions in the plus ends of microtubules.
22891263 Clathrin promotes centrosome maturation by stabilizing the microtubule-binding protein ch-TOG, defining a novel role for the clathrin-ch-TOG complex.
20838383 Data show that ILK performs its centrosome clustering activity in a centrosome-dependent, manner through the microtubule regulating proteins TACC3 and ch-TOG.
20566684 the association between aurora A phosphorylation and spindle apparatus; regulation from aurora A is mediated by CHC in recruiting phospho-TACC3 and subsequently ch-TOG to mitotic spindles.
More...

AA Sequence

MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLE      1 - 70
AALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKI     71 - 140
IVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQ    141 - 210
LKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKL    211 - 280
PKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVG    281 - 350
LRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFI    351 - 420
ARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKI    421 - 490
KECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAKAGGPPKKGKP    491 - 560
AAPGGAGNTGTKNKKGLETKEIVEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELM    561 - 630
DRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAK    631 - 700
EAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPA    701 - 770
VRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDE    771 - 840
PDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLN    841 - 910
DSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEG    911 - 980
EDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCVPHLYSCLEDRNGDVRKKAQDALPFFMMHLG    981 - 1050
YEKMAKATGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEP   1051 - 1120
KPDPKKAKAPGLSSKAKSAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRD   1121 - 1190
EYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSV   1191 - 1260
LMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIM   1261 - 1330
EGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQ   1331 - 1400
VFKLIGNLSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKLNQARSM   1401 - 1470
SGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTAS   1471 - 1540
TINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEI   1541 - 1610
IKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSD   1611 - 1680
QTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQ   1681 - 1750
CKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCRMMKHSMDQTGSKSDKETEKGASRI   1751 - 1820
DEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEME   1821 - 1890
REGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRPPLT   1891 - 1960
SLLSKPAVPTVASSTDMLHSKLSQLRESREQHQHSDLDSNQTHSSGTVTSSSSTANIDDLKKRLERIKSS   1961 - 2030
RK                                                                       2031 - 2032
//

Text Mined References (57)

PMID Year Title
27156448 2016 A TOG Protein Confers Tension Sensitivity to Kinetochore-Microtubule Attachments.
26497677 2015 Eribulin targets a ch-TOG-dependent directed migration of cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
25596274 2015 TACC3-ch-TOG track the growing tips of microtubules independently of clathrin and Aurora-A phosphorylation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24966168 2014 The XMAP215 family drives microtubule polymerization using a structurally diverse TOG array.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24273164 2014 The centrosomal adaptor TACC3 and the microtubule polymerase chTOG interact via defined C-terminal subdomains in an Aurora-A kinase-independent manner.
23532825 2013 Specific removal of TACC3-ch-TOG-clathrin at metaphase deregulates kinetochore fiber tension.
More...