Property Summary

NCBI Gene PubMed Count 4
PubMed Score 14.76
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Varicocele 21 4.057 2.0

Expression

Synonym

Accession Q13939 Q9BXG7
Symbols BTBD20
KBTBD14

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Anole lizard OMA Inparanoid

AA Sequence

MKLEFTEKNYNSFVLQNLNRQRKRKEYWDMALSVDNHVFFAHRNVLAAVSPLVRSLISSNDMKTADELFI      1 - 70
TIDTSYLSPVTVDQLLDYFYSGKVVISEQNVEELLRGAQYFNTPRLRVHCNDFLIKSICRANCLRYLFLA     71 - 140
ELFELKEVSDVAYSGIRDNFHYWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKE    141 - 210
DREKYFKKFFNYINLNAVSNKTLVFASNKLVGMENTSSHTTLIESVLMDRKQERPCSLLVYQRKGALLDS    211 - 280
VVILGGQKAHGQFNDGVFAYIIQENLWMKLSDMPYRAAALSATSAGRYIYISGGTTEQISGLKTAWRYDM    281 - 350
DDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEVWCLAGKMSIPMDGTAVIT    351 - 420
KGDRHLYIVTGRCLVKGYISRVGVVDCFDTSTGDVVQCITFPIEFNHRPLLSFQQDNILCVHSHRQSVEI    421 - 490
NLQKVKASKTTTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNAFLLDQKTGKW    491 - 560
KTLAPPPEALDCPACCLAKLPCKILQRI                                              561 - 588
//

Text Mined References (4)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11090452 2000 Actin-binding properties and colocalization with actin during spermiogenesis of mammalian sperm calicin.
7641791 1995 Molecular nature of calicin, a major basic protein of the mammalian sperm head cytoskeleton.