Property Summary

NCBI Gene PubMed Count 4
PubMed Score 14.76
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Varicocele 21 4.057 2.0

Expression

Synonym

Accession Q13939 Q9BXG7
Symbols BTBD20
KBTBD14

Gene

AA Sequence

MKLEFTEKNYNSFVLQNLNRQRKRKEYWDMALSVDNHVFFAHRNVLAAVSPLVRSLISSNDMKTADELFI      1 - 70
TIDTSYLSPVTVDQLLDYFYSGKVVISEQNVEELLRGAQYFNTPRLRVHCNDFLIKSICRANCLRYLFLA     71 - 140
ELFELKEVSDVAYSGIRDNFHYWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKE    141 - 210
DREKYFKKFFNYINLNAVSNKTLVFASNKLVGMENTSSHTTLIESVLMDRKQERPCSLLVYQRKGALLDS    211 - 280
VVILGGQKAHGQFNDGVFAYIIQENLWMKLSDMPYRAAALSATSAGRYIYISGGTTEQISGLKTAWRYDM    281 - 350
DDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEVWCLAGKMSIPMDGTAVIT    351 - 420
KGDRHLYIVTGRCLVKGYISRVGVVDCFDTSTGDVVQCITFPIEFNHRPLLSFQQDNILCVHSHRQSVEI    421 - 490
NLQKVKASKTTTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNAFLLDQKTGKW    491 - 560
KTLAPPPEALDCPACCLAKLPCKILQRI                                              561 - 588
//

Text Mined References (4)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11090452 2000 Actin-binding properties and colocalization with actin during spermiogenesis of mammalian sperm calicin.
7641791 1995 Molecular nature of calicin, a major basic protein of the mammalian sperm head cytoskeleton.