Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.89
PubTator Score 89.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
aldosterone-producing adenoma 1.337 2.4e-02
Breast cancer 1.100 6.4e-05
breast carcinoma 1.200 8.4e-23
chronic rhinosinusitis -1.008 4.1e-02
Endometriosis -1.214 1.2e-02
ependymoma 3.400 4.6e-02
interstitial cystitis -1.600 1.6e-03
invasive ductal carcinoma 1.600 5.2e-03
nasopharyngeal carcinoma -2.300 1.8e-07
osteosarcoma -1.110 2.8e-02
ovarian cancer 1.300 5.4e-03
Pick disease 1.200 3.9e-02
spina bifida -1.036 3.6e-02

Gene RIF (4)

AA Sequence

MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD      1 - 70
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV     71 - 140
LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL                         141 - 189
//

Text Mined References (18)

PMID Year Title