Property Summary

NCBI Gene PubMed Count 18
Grant Count 545
R01 Count 185
Funding $155,444,157.09
PubMed Score 16.61
PubTator Score 89.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
posterior fossa group B ependymoma 5.900 0.000
osteosarcoma -1.110 0.028
interstitial cystitis -2.900 0.000
aldosterone-producing adenoma 1.337 0.024
nasopharyngeal carcinoma -2.400 0.000
Endometriosis -1.383 0.011
breast carcinoma 1.200 0.000
spina bifida -1.036 0.036
Pick disease 1.500 0.043
Breast cancer 1.100 0.000
invasive ductal carcinoma 1.800 0.007
ovarian cancer 1.300 0.005
chronic rhinosinusitis -1.008 0.041

Synonym

Accession Q13938 Q3MJA7 Q8WUZ3
Symbols CAPS1

Gene

PDB

3E3R  

Gene RIF (4)

PMID Text
20468064 Observational study of gene-disease association. (HuGE Navigator)
19275752 The calcyphosine crystal diffracted to 2.8 A and belonged to space group P2(1)2(1)2, with the unit cell parameters a=70.39 A, b=132.02 A, c=46.20 A.
18775726 These results describe the crystal structure of Ca(2+)-loaded calcyphosine up to 2.65 A resolution and reveal a protein containing two pairs of Ca(2+)-binding EF-hand motifs.
18729184 Results demonstrated the ubiquitous overexpressions of E-FABP and CAPS in EC and the correlations to the clinicopathologic parameters. CAPS might be a potential prognostic factor for survival in patients with EC

AA Sequence

MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD      1 - 70
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV     71 - 140
LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL                         141 - 189
//

Text Mined References (18)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19275752 2009 Crystallization and preliminary crystallographic analysis of recombinant human calcyphosine.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
18775726 2008 Crystal-structure and biochemical characterization of recombinant human calcyphosine delineates a novel EF-hand-containing protein family.
18729184 2008 Prognostic evaluation of epidermal fatty acid-binding protein and calcyphosine, two proteins implicated in endometrial cancer using a proteomic approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16823975 2006 Identification of brain cell death associated proteins in human post-mortem cerebrospinal fluid.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...