Property Summary

NCBI Gene PubMed Count 44
Grant Count 6
R01 Count 4
Funding $1,339,843
PubMed Score 73.84
PubTator Score 86.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -3.400 0.019
psoriasis 2.300 0.000
non-small cell lung cancer 3.622 0.000
interstitial cystitis -1.900 0.002
spina bifida -1.680 0.040
Breast cancer -2.000 0.000

Gene RIF (28)

PMID Text
27015268 These results implicate the participation of PKP1 in early tooth morphogenesis as an effector of canonical Wnt signaling that controls ameloblast differentiation via regulation of the cell adhesion complex
26138584 Collectively, altered expression of PKP1 and SPOCK1 appears to be a frequent and critical event in prostate cancer
25631074 Cellular biotinylated plakophilin 1 protein (PKP1) is incorporated into HIV-1 Gag virus-like particles
25225333 cytoplasmic PKP1/3 are components of mRNA ribonucleoprotein particles and act as posttranscriptional regulators of gene expression.
24056861 Plakophilin-1 has a role in protecting keratinocytes from pemphigus vulgaris IgG by forming calcium-independent desmosomes
23444369 Data indicate that upon activation of growth factor signaling, plakophilin 1 switches from a desmosome-associated growth-inhibiting to a cytoplasmic proliferation-promoting function.
22170739 PKP1 loss secondary to promoter methylation, as well as other mechanisms, may promote the progression of Barrett's esophagus to esophageal adenocarcinoma in a subset of patients via decreased desmosome assembly and increased cell motility
21947748 In breast cancer, compared with normal tissue, PKP1 and PKP2 expressions were indifferent (P > 0.05), but PKP3 expression was significantly increased
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MNHSPLKTALAYECFQDQDNSTLALPSDQKMKTGTSGRQRVQEQVMMTVKRQKSKSSQSSTLSHSNRGSM      1 - 70
YDGLADNYNYGTTSRSSYYSKFQAGNGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCNTTGA     71 - 140
GSDICFMQKIKASRSEPDLYCDPRGTLRKGTLGSKGQKTTQNRYSFYSTCSGQKAIKKCPVRPPSCASKQ    141 - 210
DPVYIPPISCNKDLSFGHSRASSKICSEDIECSGLTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAK    211 - 280
QQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQL    281 - 350
TGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRKRLGMRELL    351 - 420
ALVPQRATSSRVNLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEV    421 - 490
PTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSK    491 - 560
KDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHR    561 - 630
VMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKA    631 - 700
AEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF                           701 - 747
//

Text Mined References (45)

PMID Year Title
27015268 2016 Plakophilin-1, a Novel Wnt Signaling Regulator, Is Critical for Tooth Development and Ameloblast Differentiation.
26138584 2015 Plakophilin 1-deficient cells upregulate SPOCK1: implications for prostate cancer progression.
25416956 2014 A proteome-scale map of the human interactome network.
25225333 2014 Plakophilins 1 and 3 bind to FXR1 and thereby influence the mRNA stability of desmosomal proteins.
24056861 2014 Plakophilin-1 protects keratinocytes from pemphigus vulgaris IgG by forming calcium-independent desmosomes.
23444369 2013 Insulin signaling via Akt2 switches plakophilin 1 function from stabilizing cell adhesion to promoting cell proliferation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22170739 2012 Aberrantly methylated PKP1 in the progression of Barrett's esophagus to esophageal adenocarcinoma.
21947748 2012 Expression of Plakophilins (PKP1, PKP2, and PKP3) in breast cancers.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...