Property Summary

NCBI Gene PubMed Count 34
PubMed Score 18.96
PubTator Score 20.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.083 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.100 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.005
lung cancer -1.100 0.003
group 4 medulloblastoma 1.100 0.004
lung adenocarcinoma -1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q13829 B7Z6M4 Q5TZQ1 hBACURD2
Symbols B12
B61
EDP1
BTBD34
hBACURD2

Gene

 GO Function (1)

Gene RIF (18)

PMID Text
26398148 CREB is a negative regulator of the TNFAIP1 gene.
26261520 TNFAIP1 plays an important role in mediating miR-15a dependent biological functions in osteosarcoma.
26152285 MiR-181a played a critical role in regulating pancreatic cancer growth and migration, likely interacting with TNFAIP1.
24969828 Results showed that the expression of TNFAIP1 protein was significantly increased in osteosarcoma tissues and associated with distant metastasis.
23912453 Expression of TNFAIP1 is regulated by the transcriptional factor Sp1.
22810651 TNFAIP1 inhibited the transcriptional activities of nuclear factor kappa B (NF-kappaB) and activating protein-1 reporters
20158880 suggest that the TNFAIP1/POLDIP2 complex sense-antisense architecture represents a clinically significant transcriptional structural-functional gene module associated with amplification of the genomic region on 17q11.2 in breast cancer.
19851886 CK2 could phosphorylate TNFAIP1 in vitro and in vivo, which facilitated the distribution of TNFAIP1 in nucleus and enhanced its interaction with PCNA.
19593659 The promoter region of human TNFAIP1 gene was functionally characterized.
19196817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSGDTCLCPASGAKPKLSGFKGGGLGNKYVQLNVGGSLYYTTVRALTRHDTMLKAMFSGRMEVLTDKEGW      1 - 70
ILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPII     71 - 140
TSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICC    141 - 210
WSFYGQGRKLAEVCCTSIVYATEKKQTKVEFPEARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPS    211 - 280
EDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD                                      281 - 316
//

Text Mined References (39)

PMID Year Title
26398148 2015 Transcription factor cyclic adenosine monophosphate responsive element binding protein negatively regulates tumor necrosis factor alpha-induced protein 1 expression.
26261520 2015 MiRNA-15a inhibits proliferation, migration and invasion by targeting TNFAIP1 in human osteosarcoma cells.
26152285 2015 Interaction between microRNA-181a and TNFAIP1 regulates pancreatic cancer proliferation and migration.
25416956 2014 A proteome-scale map of the human interactome network.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24969828 2014 Knockdown of TNFAIP1 inhibits growth and induces apoptosis in osteosarcoma cells through inhibition of the nuclear factor-?B pathway.
23912453 2014 Role of tumor necrosis factor alpha-induced protein 1 in paclitaxel resistance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22810651 2012 TNFAIP1 interacts with KCTD10 to promote the degradation of KCTD10 proteins and inhibit the transcriptional activities of NF-?B and AP-1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...