Property Summary

NCBI Gene PubMed Count 55
Grant Count 63
R01 Count 41
Funding $7,293,365.44
PubMed Score 127.86
PubTator Score 107.29

Knowledge Summary

Patent

No data available

Synonym

Accession Q13772 A8K8W5 B4E260 E9PAV7 J3KQN8 Q14239 NCoA-4
Symbols RFG
ELE1
PTC3
ARA70

Gene

PDB

1T5Z  

Gene RIF (31)

PMID Text
26436293 Ubiquitin-dependent NCOA4 turnover is promoted by excess iron and involves an iron-dependent interaction between NCOA4 and the HERC2 ubiquitin ligase.
25327288 provide a new mechanism for selective autophagy of ferritin and reveal a previously unappreciated role for autophagy and NCOA4 in the control of iron homeostasis in vivo
24957039 RET/PTC3 gene rearrangements are the most prevalent form of rearrangements in papillary thyroid carcinomas of Chennai population.
24910095 NCOA4 acts as a regulator of DNA replication origins that helps prevent inappropriate DNA synthesis and replication stress.
24695223 identification of NCOA4 as a selective cargo receptor for autophagic turnover of ferritin (ferritinophagy), which is critical for iron homeostasis, and provides a resource for further dissection of autophagosomal cargo-receptor connectivity
24122203 mechanism dissection shows that KLK2 may cooperate with the AR coregulator, ARA70, to enhance AR transactivation that may result in alteration of prostate cancer formation
22887727 Data indicate that the increase in prostate cancer (PC) risk associated with rs10993994:C>T is likely mediated by the variant's effect of MSMB-encoded protein PSP94 expression; however, this effect does not extend to NCOA4 in the data.
22661295 Computational network analysis reveals that the MSMB gene is functionally connected to NCOA4 and the androgen receptor signaling pathway. The data provide an example of how GWAS-associated variants may have multiple genetic and epigenetic effects
22562579 Studies indicate nuclear receptor coactivator 4 (NcoA4) as a coactivator for a variety of nuclear receptors.
21085629 Suppression of MSMB expression or NCOA4 overexpression promotes anchorage-independent growth of prostate epithelial cells.
More...

AA Sequence

MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL      1 - 70
YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF     71 - 140
EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP    141 - 210
ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS    211 - 280
FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC    281 - 350
QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE    351 - 420
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK    421 - 490
NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL    491 - 560
LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM                    561 - 614
//

Text Mined References (58)

PMID Year Title
26436293 2015 Ferritinophagy via NCOA4 is required for erythropoiesis and is regulated by iron dependent HERC2-mediated proteolysis.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24957039 2014 Prevalence of RET/PTC1 and RET/PTC3 gene rearrangements in Chennai population and its correlation with clinical parameters.
24910095 2014 NCOA4 transcriptional coactivator inhibits activation of DNA replication origins.
24695223 2014 Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy.
24122203 2014 Human kallikrein 2 (KLK2) promotes prostate cancer cell growth via function as a modulator to promote the ARA70-enhanced androgen receptor transactivation.
22887727 2013 Investigation of the relationship between prostate cancer and MSMB and NCOA4 genetic variants and protein expression.
22661295 2012 Promoter variants in the MSMB gene associated with prostate cancer regulate MSMB/NCOA4 fusion transcripts.
22562579 2012 Expression and function of nuclear receptor co-activator 4: evidence of a potential role independent of co-activator activity.
21085629 2010 Analysis of the 10q11 cancer risk locus implicates MSMB and NCOA4 in human prostate tumorigenesis.
More...