Property Summary

NCBI Gene PubMed Count 56
PubMed Score 135.96
PubTator Score 107.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.300 7.1e-04
ovarian cancer -1.700 3.9e-05
pancreatic ductal adenocarcinoma liver m... -1.450 1.4e-02
Waldenstrons macroglobulinemia 1.595 3.8e-03

Protein-protein Interaction (6)

Gene RIF (32)

AA Sequence

MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL      1 - 70
YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF     71 - 140
EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP    141 - 210
ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS    211 - 280
FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC    281 - 350
QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE    351 - 420
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK    421 - 490
NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL    491 - 560
LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM                    561 - 614
//

Text Mined References (59)

PMID Year Title