Property Summary

NCBI Gene PubMed Count 34
PubMed Score 16.79
PubTator Score 21.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.003
osteosarcoma -1.262 0.003
lung cancer 1.400 0.001
group 3 medulloblastoma 1.100 0.001
ovarian cancer 1.200 0.001

Synonym

Accession Q13769 O60839 Q9UPZ5
Symbols Fmip
PK1.3
fSAP79
C22orf19

Gene

 GO Function (1)

 GWAS Trait (1)

Gene RIF (7)

PMID Text
24023261 THOC5 to be a novel gene involved in the regulation of serum HDL-C levels
23685434 Authors suggest a model in which human Thoc5 controls polyadenylation site choice through the co-transcriptional loading of CFIm68 onto target genes.
23032722 show that THOC5 Y225 phosphorylation governs mRNA binding. In addition, CXCL12 is shown to induce THOC5 Y225 phosphorylation, and site-directed mutagenesis demonstrates that this modulates motile response
21937706 show here that DNA damage drastically decreased the cytoplasmic pool of a set of THOC5-dependent mRNAs and impaired the THOC5/mRNA complex formation
19165146 Thoc5 exhibits in vitro RNA-binding activity and is associated with HSP70 mRNPs in vivo as a component of the stable THO complex
19059247 THOC7 (50-137, amino acid numbers) binds to the N-terminal portion (1-199) of FMIP directly.
19015024 THOC5 protein expression can potentiate receptor signalling to transcription factor expression and monocyte differentiation.

AA Sequence

MSSESSKKRKPKVIRSDGAPAEGKRNRSDTEQEGKYYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQ      1 - 70
DLKSRGGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHL     71 - 140
QKEITKCLEFKSKHEEIDLVSLEEFYKEAPPDISKAEVTMGDPHQQTLARLDWELEQRKRLAEKYRECLS    141 - 210
NKEKILKEIEVKKEYLSSLQPRLNSIMQASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQ    211 - 280
ACDKTLSVAIEGSVDEAKALFKPPEDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVML    281 - 350
DLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQY    351 - 420
QFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALH    421 - 490
KQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTVAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGT    491 - 560
AKLQAAVVLNPGYSSIPPVFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLC    561 - 630
VLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR                     631 - 683
//

Publication (47)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24023261 2013 THOC5: a novel gene involved in HDL-cholesterol metabolism.
23685434 2013 Human TREX component Thoc5 affects alternative polyadenylation site choice by recruiting mammalian cleavage factor I.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23032722 2013 A pathway from leukemogenic oncogenes and stem cell chemokines to RNA processing via THOC5.
More...