Property Summary

NCBI Gene PubMed Count 82
Grant Count 95
R01 Count 34
Funding $25,375,588.19
PubMed Score 273.20
PubTator Score 150.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13642 B7Z5T4 B7Z793 O95212 Q13230 Q13645 Q5JXI7 Q5M7Y6 Q6IB30 Q9NZ40 Q9UKZ8 Q9Y630 FHL-1
Symbols KYOT
SLIM
FHL-1
FHL1A
FHL1B
FLH1A
SLIM1
XMPMA
RBMX1A
RBMX1B
SLIM-1
SLIMMER

Gene

PDB

1X63   2CUP   2CUR   2EGQ  

Gene RIF (57)

PMID Text
26551678 results indicate that anti-FHL1 autoantibodies in peripheral blood have promising potential as a biomarker to identify a subset of severe IIM.
26146054 FHL1 shRNA could significantly accelerate tumor cell growth via inhibiting the expression of FHL1
26017856 Knockdown of FHL1 with FHL1 small interfering RNA (siRNA) promoted tumor growth and Cyclin D and cyclin E were markedly elevated at both the protein and mRNA level.
25724586 In healthy individuals, FHL1A is the predominant splice variant and is mainly found in skeletal and cardiac muscle. In two individuals with an Emery-Dreifuss plus phenotype with pulmonary artery hypoplasia and facial dysmorphology, there was demonstrated loss of isoform A and B, and an almost 200-fold overexpression of isoform C.
25695429 FRG1 mice overexpressing FHL1 showed an improvement in the dystrophic phenotype
25305316 FHL-1 is the predominant complement regulator in Bruch's membrane having direct implications for age-related macular degeneration.
25272045 Our results suggest that miR-410 may function as an oncomiR and are consistent with its key function in regulating FHL1 in certain digestive system cancers.
24952875 The study has revealed that FHL1C overexpression induces Jurkat cell apoptosis.
24634512 This is the first study to show that FHL1 mutations identified in several clinically distinct myopathies lead to similar protein aggregation and impair myotube formation.
24516350 These data suggested that up-regulated FHL1 in smooth muscle in HSCR might be associated with intestinal wall remodeling in HSCR and might be one of the risk factors for gastrointestinal motor dysfunction
More...

AA Sequence

MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK      1 - 70
CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS     71 - 140
FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV    141 - 210
DCYKNFVAKKCAGCKNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWV    211 - 280
VVLYRKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP                               281 - 323
//

Text Mined References (83)

PMID Year Title
27234031 2016 Improved diagnostic yield of neuromuscular disorders applying clinical exome sequencing in patients arising from a consanguineous population.
26551678 2015 Development of autoantibodies against muscle-specific FHL1 in severe inflammatory myopathies.
26146054 2015 [FHL1 knockdown mediated by lentiviral shRNA promotes the growth of HeLa and HepG2 cells].
26017856 2015 FHL1 inhibits the growth of tongue squamous cell carcinoma cells via G1/S cell cycle arrest.
25724586 2015 A novel single nucleotide splice site mutation in FHL1 confirms an Emery-Dreifuss plus phenotype with pulmonary artery hypoplasia and facial dysmorphology.
25695429 2015 FHL1 reduces dystrophy in transgenic mice overexpressing FSHD muscular dystrophy region gene 1 (FRG1).
25305316 2014 Identification of factor H-like protein 1 as the predominant complement regulator in Bruch's membrane: implications for age-related macular degeneration.
25272045 2014 MiR-410 is overexpressed in liver and colorectal tumors and enhances tumor cell growth by silencing FHL1 via a direct/indirect mechanism.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24952875 2014 FHL1C induces apoptosis in Notch1-dependent T-ALL cells through an interaction with RBP-J.
More...