Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.05
PubTator Score 3.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.800 0.009
ependymoma -4.300 0.000
oligodendroglioma -1.900 0.000
glioblastoma -4.200 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -3.600 0.000
pediatric high grade glioma -3.800 0.000
sonic hedgehog group medulloblastoma -2.900 0.000
pilocytic astrocytoma -3.800 0.000
lung carcinoma 2.000 0.000
Down syndrome -1.100 0.011

Synonym

Accession Q13634 A8K0I2 B4DHG6 Q8N5Z2
Symbols CDH14
CDH24
CDH14L

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20180417 Azoospermic testis showed down-regulation of CDH18 and PCDH17.

AA Sequence

MKITSTSCICPVLVCLCFVQRCYGTAHHSSIKVMRNQTKHIEGETEVHHRPKRGWVWNQFFVLEEHMGPD      1 - 70
PQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLE     71 - 140
PESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYGNSARVVYSILQGQPYFSV    141 - 210
DPKTGVIRTALHNMDREAREHYSVVIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPES    211 - 280
AQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFSISTDKETREGILSLKKPLNYEKKKSYTLNIEGA    281 - 350
NTHLDFRFSHLGPFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVVGTVLAQDPDSTNSLVRYF    351 - 420
INYNVEDDRFFNIDANTGTIRTTKVLDREETPWYNITVTASEIDNPDLLSHVTVGIRVLDVNDNPPELAR    421 - 490
EYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTV    491 - 560
QDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTCHAEAFLSSAGLSTGALIAILLCVLILLAIV    561 - 630
VLFITLRRSKKEPLIISEEDVRENVVTYDDEGGGEEDTEAFDITALRNPSAAEELKYRRDIRPEVKLTPR    631 - 700
HQTSSTLESIDVQEFIKQRLAEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYHYLGDW    701 - 770
GPEFKKLAELYGEIESERTT                                                      771 - 790
//

Publication (15)

PMID Year Title
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
20800221 2010 Genome-wide association scan of trait depression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20180417 2009 [Expressions of cadherin molecules CDH18 and PCDH17 in human azoospermic testes].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...