Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.11
PubTator Score 3.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.500 3.1e-08
astrocytic glioma -1.900 1.8e-03
Astrocytoma, Pilocytic -3.800 2.5e-09
atypical teratoid / rhabdoid tumor -3.800 5.1e-08
Down syndrome -1.100 1.1e-02
ependymoma -2.700 3.7e-03
glioblastoma -3.900 8.2e-12
group 4 medulloblastoma 1.500 2.5e-03
lung carcinoma 2.000 3.4e-11
medulloblastoma, large-cell -3.400 1.6e-05
oligodendroglioma -1.400 2.5e-02
primitive neuroectodermal tumor -3.600 5.6e-05

Gene RIF (2)

AA Sequence

MKITSTSCICPVLVCLCFVQRCYGTAHHSSIKVMRNQTKHIEGETEVHHRPKRGWVWNQFFVLEEHMGPD      1 - 70
PQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLE     71 - 140
PESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYGNSARVVYSILQGQPYFSV    141 - 210
DPKTGVIRTALHNMDREAREHYSVVIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPES    211 - 280
AQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFSISTDKETREGILSLKKPLNYEKKKSYTLNIEGA    281 - 350
NTHLDFRFSHLGPFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVVGTVLAQDPDSTNSLVRYF    351 - 420
INYNVEDDRFFNIDANTGTIRTTKVLDREETPWYNITVTASEIDNPDLLSHVTVGIRVLDVNDNPPELAR    421 - 490
EYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTV    491 - 560
QDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTCHAEAFLSSAGLSTGALIAILLCVLILLAIV    561 - 630
VLFITLRRSKKEPLIISEEDVRENVVTYDDEGGGEEDTEAFDITALRNPSAAEELKYRRDIRPEVKLTPR    631 - 700
HQTSSTLESIDVQEFIKQRLAEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYHYLGDW    701 - 770
GPEFKKLAELYGEIESERTT                                                      771 - 790
//

Text Mined References (15)

PMID Year Title