Property Summary

NCBI Gene PubMed Count 65
Grant Count 19
R01 Count 19
Funding $1,575,270.47
PubMed Score 46.32
PubTator Score 37.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis -1.300 0.000
osteosarcoma 1.254 0.001
ependymoma 1.200 0.000
medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 1.900 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.200 0.000
Hydrolethalus syndrome 1.232 0.048
lung cancer 1.100 0.032
pediatric high grade glioma 1.500 0.000
spina bifida -1.654 0.038
ovarian cancer -1.900 0.000
Gaucher disease type 3 -1.200 0.021

Gene RIF (41)

PMID Text
26617747 these results showed that knockdown of CUL4B inhibit proliferation and promotes apoptosis of colorectal cancer cells through suppressing the Wnt/beta-catenin signaling pathway
26021757 Our data are consistent with the idea that the CUL4A/B-DDB1-CRBN complex catalyses the polyubiquitination and thus controls the degradation of CLC-1 channels.
25970626 FBXO44-mediated degradation of RGS2 protein uniquely depends on a Cul4B/DDB1 complex.
25807049 HIV-1 Vpr complexes with DCAF1, DDB1, CUL4A, CUL4B, and UNG2 proteins in the cullin4 (CUL4)-containing ubiquitin ligase complex in HEK293T cells
25542213 Results show that CUL4A- and CUL4B-mediated polyubiquitination of gamma-tubulin for its degradation.
25464270 results established a critical role of CUL4B in negatively regulating the p53-ROS positive feedback loop that drives cellular senescence
25430888 CUL4B can up-regulate Wnt/beta-catenin signalling in human HCC through transcriptionally repressing Wnt antagonists and thus contributes to the malignancy of HCC.
25385192 Data show that CUL4B variants are associated with a wide range of cerebral malformations and suggest an important role in brain through its interaction with WDR62, a protein in which variants were identified in patients with cerebral malformations.
25189186 Results demonstrated that CUL4B promotes cell proliferation and inhibits the apoptosis of osteosarcoma cells.
24898194 The intellectual disability phenotype is caused by aberrant splicing and removal of intron 7 from CUL4B gene primary transcript.
More...

AA Sequence

MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSSNSS      1 - 70
NEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSS     71 - 140
SSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIKNFKDKPKLPE    141 - 210
NYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSL    211 - 280
DSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGI    281 - 350
LLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR    351 - 420
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVL    421 - 490
LQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPNKPA    491 - 560
ELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSML    561 - 630
SKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPE    631 - 700
MVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQA    701 - 770
TGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE    771 - 840
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYN    841 - 910
YIA                                                                       911 - 913
//

Publication (79)

PMID Year Title
26617747 2015 Knockdown of CUL4B inhibits proliferation and promotes apoptosis of colorectal cancer cells through suppressing the Wnt/?-catenin signaling pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26021757 2015 The Cullin 4A/B-DDB1-Cereblon E3 Ubiquitin Ligase Complex Mediates the Degradation of CLC-1 Chloride Channels.
25970626 2015 FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex.
25542213 2015 Cullin 4A and 4B ubiquitin ligases interact with ?-tubulin and induce its polyubiquitination.
25464270 2015 CUL4B impedes stress-induced cellular senescence by dampening a p53-reactive oxygen species positive feedback loop.
25430888 2015 CUL4B activates Wnt/?-catenin signalling in hepatocellular carcinoma by repressing Wnt antagonists.
25385192 2015 Variants in CUL4B are associated with cerebral malformations.
25189186 2014 CUL4B promotes proliferation and inhibits apoptosis of human osteosarcoma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
More...