Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent (5,835)


Accession Q13607 A4D2G1 Q6IFP7 Q96R49 Q9UDX1
Symbols OLF3


  Ortholog (2)

Species Source
Macaque OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

LTPMLNPMIYSLRNKEVKGAWQKLLWKFSGLTSKLAT                                     281 - 317

Text Mined References (11)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9500546 1998 Distribution of olfactory receptor genes in the human genome.