Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent (5,835)

AA Sequence

LTPMLNPMIYSLRNKEVKGAWQKLLWKFSGLTSKLAT                                     281 - 317

Text Mined References (11)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9500546 1998 Distribution of olfactory receptor genes in the human genome.