Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.67
PubTator Score 3.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer -1.100 0.006
hepatocellular carcinoma -1.100 0.002
pancreatic cancer -1.500 0.004
interstitial lung disease 1.200 0.021
Multiple myeloma 1.001 0.006
astrocytic glioma 1.700 0.008
ependymoma 1.800 0.009
oligodendroglioma 1.600 0.007
psoriasis -2.800 0.000
osteosarcoma 3.189 0.000
group 3 medulloblastoma 1.400 0.047
diabetes mellitus -1.100 0.003
pancreatic carcinoma -1.500 0.004
acute myeloid leukemia 1.300 0.031
Pick disease 1.200 0.000

Gene RIF (7)

PMID Text
25970345 Overexpression of either Tra2alpha or Tra2beta results in a marked reduction in HIV-1 Gag/ Env expression.
25970345 HIV-1 Env protein expression is inhibited by the overexpression of TRA2A (in 293T cells), both full length isoform and truncated N-terminal isoform
25970345 HIV-1 Env protein expression is inhibited by the overexpression of TRA2A (in 293T cells), both full length isoform and truncated N-terminal isoform
25970345 HIV-1 RNA splice site usage is altered by the overexpression of TRA2A (in 293T cells) and different isoforms of TRA2A exhibit different altered splice site usage patterns
23255807 findings show the inclusion of both HIV-1 exon 3 and vpr mRNA processing is promoted by an exonic splicing enhancer (ESEvpr) localized between exonic splicing silencer ESSV and 5'ss D3; the ESEvpr sequence was found to be bound by members of the Tra2 protein family
23255807 HIV-1 Env protein expression is inhibited by the overexpression of TRA2A (in 293T cells), both full length isoform and truncated N-terminal isoform
21447598 Expression of tumor-promoting Cyr61 is regulated by hTRA2-beta1 and acidosis.

AA Sequence

MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTR      1 - 70
SRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFS     71 - 140
RYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMG    141 - 210
RPTHSGGGGGGGGGGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPR    211 - 280
RY                                                                        281 - 282
//

Text Mined References (27)

PMID Year Title
25970345 2015 Differential Effects of Tra2ß Isoforms on HIV-1 RNA Processing and Expression.
23255807 2013 Tra2-mediated recognition of HIV-1 5' splice site D3 as a key factor in the processing of vpr mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21447598 2011 Expression of tumor-promoting Cyr61 is regulated by hTRA2-?1 and acidosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...