Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.34
PubTator Score 3.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia 1.300 3.1e-02
astrocytic glioma 1.700 8.2e-03
diabetes mellitus -1.100 2.8e-03
ependymoma 1.800 9.3e-03
gastric cancer -1.100 6.2e-03
group 3 medulloblastoma 1.400 4.7e-02
hepatocellular carcinoma -1.100 1.9e-03
interstitial lung disease 1.200 2.1e-02
Multiple myeloma 1.001 6.4e-03
oligodendroglioma 1.600 7.4e-03
osteosarcoma 3.189 2.9e-07
pancreatic cancer -1.500 3.5e-03
pancreatic carcinoma -1.500 3.5e-03
Pick disease -1.100 3.6e-05
psoriasis -2.800 8.5e-05

 GWAS Trait (1)

Pathway (1)

Gene RIF (6)

AA Sequence

MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTR      1 - 70
SRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFS     71 - 140
RYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMG    141 - 210
RPTHSGGGGGGGGGGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPR    211 - 280
RY                                                                        281 - 282
//

Text Mined References (28)

PMID Year Title