Property Summary

NCBI Gene PubMed Count 13
Grant Count 13
R01 Count 10
Funding $1,772,750.08
PubMed Score 30.86
PubTator Score 14.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.682 0.000
tuberculosis and treatment for 6 months -1.100 0.000
lung carcinoma -1.100 0.000

Gene RIF (5)

PMID Text
23333304 HIV-1 Vif downregulates the expression of GRB2-related adaptor protein (GRAP) in Vif-expression T cells
19836472 Grb2-related adaptor protein (GRAP) was up-regulated in kidney tubules from fibrotic kidneys from diabetic patients, and subsequently confirmed as a novel component of TGF-beta signaling in cultured human renal tubule cells.
18295596 Our findings define a pathway involving CD28 binding to Grb-2 and its co-operativity with Vav1 in the regulation of T-cell co-stimulation.
15174222 Results suggest that the GRAP gene might have a role in the pathogenesis of Sjogren's syndrome.
12491092 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRISRQLA      1 - 70
EEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTI     71 - 140
AKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRS    141 - 210
YVQPVHL                                                                   211 - 217
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19836472 2010 Quantitative mass spectrometry of diabetic kidney tubules identifies GRAP as a novel regulator of TGF-beta signaling.
18295596 2008 CD28 and Grb-2, relative to Gads or Grap, preferentially co-operate with Vav1 in the activation of NFAT/AP-1 transcription.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15174222 Detection of Grb-2-related adaptor protein gene (GRAP) and peptide molecule in salivary glands of MRL/lpr mice and patients with Sjögren's syndrome.
12819203 2003 GC-GAP, a Rho family GTPase-activating protein that interacts with signaling adapters Gab1 and Gab2.
12491092 2003 Polymorphisms of four bone mineral density candidate genes in Chinese populations and comparison with other populations of different ethnicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11741599 2001 Multiple interactions of the cytosolic polyproline region of the CD95 ligand: hints for the reverse signal transduction capacity of a death factor.
More...