Property Summary

NCBI Gene PubMed Count 92
Grant Count 253
R01 Count 188
Funding $21,965,887.84
PubMed Score 320.62
PubTator Score 195.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.700 0.010
posterior fossa group A ependymoma -3.500 0.000
oligodendroglioma -1.500 0.032
glioblastoma -3.300 0.000
group 4 medulloblastoma 3.500 0.001
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell 2.500 0.009
pancreatic cancer -1.300 0.023
pediatric high grade glioma -2.200 0.004
pilocytic astrocytoma -3.100 0.000
subependymal giant cell astrocytoma -6.510 0.001
gastric carcinoma -1.100 0.043
ovarian cancer -1.200 0.000
pituitary cancer 2.300 0.000

Synonym

Accession Q13562 B2R9I8 F1T0E1 O00343 Q13340 Q5U095 Q96TH0 Q99455 Q9UEC8 NeuroD
Symbols BETA2
BHF-1
MODY6
NEUROD
bHLHa3

Gene

PANTHER Protein Class (2)

Gene RIF (75)

PMID Text
26773576 Study reports a family with autosomal dominant diabetes related to a new NEUROD1 mutation, one of very few meeting Maturity Onset Diabetes of the Young criteria.
25652313 this study concludes that the novel mechanism would regulate the expression of ALK in neuroblastoma and that NeuroD1 should be significantly involved in neuroblastoma tumorigenesis.
25477324 NEUROD1 is important for maintenance of the retina function and partial loss-of-function mutation in NEUROD1 is likely a rare cause of nonsyndromic ARRP.
24732800 Transactivation of Ctbp was dependent on the histone H3 lysine 9 (H3K9) demethylase activity of LSD1 facilitates subsequent H3K9 acetylation by the NeuroD1-associated histone acetyltransferase, P300/CBP-associated factor.
24719457 Increased expression of NeuroD1 subsequently leads to regulation of expression and function of the nicotinic acetylcholine receptor subunit cluster of alpha3, alpha5, and beta4.
24464628 RNAi of lentiviral vector target NeuroD can reduce the migration and invasion abilities of PANC-1 cells
23739064 Gene expression profiling revealed that permissive lines are typified by lower expression of the early neurogenic transcription factor ASCL1 and, conversely, by higher expression of the late neurogenic transcription factor NEUROD1.
23553831 NeuroD1 regulates survival and migration of neuroendocrine lung carcinomas via signaling molecules TrkB and NCAM.
23203005 The variant A45T does not play a major role in the development of T2 Diabetes mellitus in East Asian descent.
22761608 Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells
More...

AA Sequence

MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEEDSLRNGGEEEDEDEDLEEEE      1 - 70
EEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKI     71 - 140
ETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTA    141 - 210
SASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSIN    211 - 280
GNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL    281 - 350
NAIFHD                                                                    351 - 356
//

Text Mined References (94)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26773576 2016 A family with the Arg103Pro mutation in the NEUROD1 gene detected by next-generation sequencing - Clinical characteristics of mutation carriers.
25652313 2015 NeuroD1 promotes neuroblastoma cell growth by inducing the expression of ALK.
25477324 2014 A homozygous missense mutation in NEUROD1 is associated with nonsyndromic autosomal recessive retinitis pigmentosa.
24732800 2014 CtBP and associated LSD1 are required for transcriptional activation by NeuroD1 in gastrointestinal endocrine cells.
24719457 2014 NeuroD1 mediates nicotine-induced migration and invasion via regulation of the nicotinic acetylcholine receptor subunits in a subset of neural and neuroendocrine carcinomas.
24464628 2014 Effect of NeuroD gene silencing on the migration and invasion of human pancreatic cancer cells PANC-1.
23739064 2013 Selective tropism of Seneca Valley virus for variant subtype small cell lung cancer.
23553831 2013 NeuroD1 regulates survival and migration of neuroendocrine lung carcinomas via signaling molecules TrkB and NCAM.
23203005 2013 Evaluation of variant A45T in NEUROD1/BETA2 for its association with type 2 diabetes mellitus.
More...