Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $510,800.67
PubMed Score 13.26
PubTator Score 9.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
23935197 These data suggest that type I IFN stimulation induces a rapid recruitment of a repressive Egr3/Nab1 complex that silences transcription from the ifngr1 promoter.
21239760 Data show that the suppressive effect of valproic acid on chondrocytes is not due to reduced expression or recruitment of Egr-1 to the mPGES-1 promoter and involves upregulation of NAB1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17853270 Methylation pattern of the corresponding NGFI-A binding site in the human glucocorticoid receptor exon 1-F specific promoter in post mortem hippocampal tissue.
12030330 mutations in the human NABI gene are most likely not involved in the pathogenesis of peripheral neuropathies.

AA Sequence

MAAALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMASKPLHVRRLQK      1 - 70
ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNAREPHLKIPKCAATTCVQSLG     71 - 140
QGKSDVVGSLALQSVGESRLWQGHHATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTL    141 - 210
PKSDLNEVKELLKTNKKLAKMIGHIFEMNDDDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAA    211 - 280
AQLCVKDNALLTRRDELFALARQISREVTYKYTYRTTKSKCGERDELSPKRIKVEDGFPDFQDSVQTLFQ    281 - 350
QARAKSEELAALSSQQPEKVMAKQMEFLCNQAGYERLQHAERRLSAGLYRQSSEEHSPNGLTSDNSDGQG    351 - 420
ERPLNLRMPNLQNRQPHHFVVDGELSRLYPSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR       421 - 487
//

Publication (25)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935197 2013 Type I IFNs downregulate myeloid cell IFN-? receptor by inducing recruitment of an early growth response 3/NGFI-A binding protein 1 complex that silences ifngr1 transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21836637 2011 The transcription factor Krox20 is an E3 ligase that sumoylates its Nab coregulators.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21239760 2011 Valproic acid suppresses interleukin-1ß-induced microsomal prostaglandin E2 synthase-1 expression in chondrocytes through upregulation of NAB1.
More...