Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.20
PubTator Score 9.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
aldosterone-producing adenoma -1.194 1.9e-02
astrocytic glioma 1.300 1.3e-02
Astrocytoma, Pilocytic 1.100 3.5e-03
atypical teratoid / rhabdoid tumor 1.400 5.7e-03
Breast cancer -1.400 4.4e-09
breast carcinoma -1.100 1.0e-28
cystic fibrosis 1.107 2.7e-04
ependymoma 1.200 9.7e-03
glioblastoma 1.400 2.8e-02
group 3 medulloblastoma 1.500 2.2e-02
intraductal papillary-mucinous adenoma (... 1.700 8.6e-04
intraductal papillary-mucinous carcinoma... 1.300 9.4e-03
intraductal papillary-mucinous neoplasm ... 1.600 8.7e-03
invasive ductal carcinoma -1.500 1.0e-02
medulloblastoma, large-cell 1.900 4.1e-03
oligodendroglioma 1.600 1.1e-02
osteosarcoma 2.392 6.5e-04
pediatric high grade glioma 1.400 4.7e-03
primitive neuroectodermal tumor 1.300 1.6e-04
psoriasis -1.500 1.2e-04
subependymal giant cell astrocytoma -1.265 3.6e-02
tuberculosis -1.600 4.8e-07

Gene RIF (5)

AA Sequence

MAAALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMASKPLHVRRLQK      1 - 70
ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNAREPHLKIPKCAATTCVQSLG     71 - 140
QGKSDVVGSLALQSVGESRLWQGHHATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTL    141 - 210
PKSDLNEVKELLKTNKKLAKMIGHIFEMNDDDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAA    211 - 280
AQLCVKDNALLTRRDELFALARQISREVTYKYTYRTTKSKCGERDELSPKRIKVEDGFPDFQDSVQTLFQ    281 - 350
QARAKSEELAALSSQQPEKVMAKQMEFLCNQAGYERLQHAERRLSAGLYRQSSEEHSPNGLTSDNSDGQG    351 - 420
ERPLNLRMPNLQNRQPHHFVVDGELSRLYPSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR       421 - 487
//

Text Mined References (26)

PMID Year Title