Property Summary

NCBI Gene PubMed Count 18
PubMed Score 85.11
PubTator Score 220.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Protein-protein Interaction (3)

Gene RIF (6)

AA Sequence

MLLGGPPRSPRSGTSPKGPWSSTGHVQFGKSPQTWPRRTRPRSPEPAAPSGVRGSTWTRRRDTPRRAGPT      1 - 70
ALSRYVGHLWMGRRPPSPEARGPVPRSSAASRARRSLASPGISPGPLTATIGGAVAGGGPRQGRAEAHKE     71 - 140
VFPGQRVGKMAAPMELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHG    141 - 210
EVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAM    211 - 280
PFPLNFFLPGRMQRQYMERLQLLTGEHRPEDEEELEKELYREARECLTLLSQRLGSQKFFFGDAPASLDA    281 - 350
FVFSYLALLLQAKLPSGKLQVHLRGLHNLCAYCTHILSLYFPWDGAEVPPQRQTPAGPETEEEPYRRRNQ    351 - 420
ILSVLAGLAAMVGYALLSGIVSIQRATPARAPGTRTLGMAEEDEEE                            421 - 466
//

Text Mined References (26)

PMID Year Title