Property Summary

NCBI Gene PubMed Count 30
Grant Count 100
R01 Count 39
Funding $10,687,884.97
PubMed Score 237.69
PubTator Score 92.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.200 0.001

Synonym

Accession Q13477 A5PKV4 B2RPL9 O60222 O75867 Q5UGI7 MAdCAM-1
Symbols MACAM1

Gene

PDB

1BQS   1GSM   4HBQ   4HC1   4HCR   4HD9  

Gene RIF (15)

PMID Text
26124182 Doxo-induced apoptosis has a role in inhibiting hepatocellular carcinoma by targeting Madcam1 and AKT and blocking protein translation initiation
23839340 MADCAM1 is up-regulated in liver cirrhosis with expression on peribiliary vascular plexus and lymphoid aggregates
23297416 Domain 1 of mucosal addressin cell adhesion molecule has an I1-set fold and a flexible integrin-binding loop.
21296888 Findings suggest that the inactive alpha4beta7 and alpha4beta7 activated by different stimuli have distinct conformations with different structural requirements for MAdCAM-1 binding.
19286444 MADCAM1 gene polymorphisms may be associated with the risk of chronic GVHD and may, also, affect mortality related to aHSCT.
19286444 Observational study of gene-disease association. (HuGE Navigator)
19157500 mucosal addressin cell adhesion molecule 1 may represent an important determinant for the generation of mucosal damage in celiac disease
18308860 Immobilized CCL25 and CCL28 are both able to trigger integrin alpha(4)beta(7)-dependent lymphocyte arrest on MAdCAM-1 under shear flow.
16750586 Observational study of gene-disease association. (HuGE Navigator)
15483224 PI3-K/Akt is involved in the gut-specific differentiation of human intestinal microvascular endothelial cells, which results in expression of the mucosal addressin MAdCAM-1
More...

AA Sequence

MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAV      1 - 70
QSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVT     71 - 140
PVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRL    141 - 210
PGLELSHRQAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTH    211 - 280
TPRSPGSTRTRRPEISQAGPTQGEVIPTGSSKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAE    281 - 350
DDTHPPASLRLLPQVSAWAGLRGTGQVGISPS                                          351 - 382
//

Text Mined References (32)

PMID Year Title
26124182 2015 Doxorubicin induces apoptosis by targeting Madcam1 and AKT and inhibiting protein translation initiation in hepatocellular carcinoma cells.
23986478 2013 Disruption of disulfide restriction at integrin knees induces activation and ligand-independent signaling of ????.
23839340 2013 Mucosal addressin cell adhesion molecule (MAdCAM-1) expression is upregulated in the cirrhotic liver and immunolocalises to the peribiliary plexus and lymphoid aggregates.
23297416 2013 Domain 1 of mucosal addressin cell adhesion molecule has an I1-set fold and a flexible integrin-binding loop.
21296888 2011 The CC' and DE loops in Ig domains 1 and 2 of MAdCAM-1 play different roles in MAdCAM-1 binding to low- and high-affinity integrin alpha4beta7.
19286444 2009 Possible impact of MADCAM1 gene single nucleotide polymorphisms to the outcome of allogeneic hematopoietic stem cell transplantation.
19157500 2009 Increased expression of mucosal addressin cell adhesion molecule 1 in the duodenum of patients with active celiac disease is associated with depletion of integrin alpha4beta7-positive T cells in blood.
18308860 2008 CCL25 and CCL28 promote alpha4 beta7-integrin-dependent adhesion of lymphocytes to MAdCAM-1 under shear flow.
16750586 2006 Analysis of MAdCAM-1 and ICAM-1 polymorphisms in 365 Scandinavian patients with primary sclerosing cholangitis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...